KEGG   Mus pahari (shrew mouse): 110318574
Entry
110318574         CDS       T05929                                 

Gene name
Lrp2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04918  Thyroid hormone synthesis
mpah04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110318574 (Lrp2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    110318574 (Lrp2)
  09154 Digestive system
   04979 Cholesterol metabolism
    110318574 (Lrp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110318574 (Lrp2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    110318574 (Lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 EGF_CA SGL
Other DBs
NCBI-GeneID: 110318574
NCBI-ProteinID: XP_021049394
Ensembl: MGP_PahariEiJ_G0025073
LinkDB
Position
3
AA seq 4660 aa
MERGAAAAAWMLLLAIAACLAPVSGQECGSGSFRCDNGYCIPASWRCDGTRDCLDDTDEI
GCPPRSCASGFFLCPAEGTCIPNSWVCDQDKDCSDGADEQQNCPGTTCSSQQLTCSNGQC
VPIEYRCDHVSDCPDGSDERNCHYPTCDQLTCANGACYNTSQKCDHKVDCRDSSDEANCT
TLCSQKEFECGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCSNGQCINQNWV
CDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGGDENNA
TSGRHCGTGLCSILNCEYQCYQTPYGGECFCPSGHIINSNDSRTCINFDDCQIWGICDQK
CENRQGRHQCLCEEGYILERGQHCKSNNSFSAASIIFSNGRDLLVGDLHGRNFRILAESK
NRGIVMGVDFHYQKHRVFWTDPMQSKVFSTDINGLNTQEILNVSVDAPENLAVDWINNKL
YLVETRVNRIDVVNLEGNQRVTLITENLGHPRGIALDPTVGYLFFSDWGSLSGQPKVERA
FMDGSNRKDLVTTKLGWPAGITLDLVSKRVYWVDSRYDYIETVTYDGIQRKTVARGGSLV
PHPFGITLFEEHVFFTDWTKMAVMKANKFTETNPQVYHQSSLTPFGVTVYHALRQPNATN
PCGSNNGGCAQICVLSHRTDNGGLGYRCKCEFGFELDADEHHCVAVKNFLLFSSQTAVRG
IPFTLSTQEDVMVPVTGSPSFFVGIDFDAQHSTIFYSDLSKDIIYKQKIDGTGKEVLTAN
RLENVECLSFDWISRNLYWTDGGLKSVTVMKLADKSRRQIISNLNNPRSIVVHPTAGYMF
LSDWFRPAKIMRAWSDGSHLMPIVNTSLGWPNGLAIDWSASRLYWVDAFFDKIEHSNLDG
LDRKRLGHVDQMTHPFGLTVFKDNVFLTDWRLGAIIRVRKSDGGDMTIVRSGISSIMHVK
AYDADLQTGSNFCSQTTHPNGDCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREP
PTQQCGSFSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTCAHGGQCI
PGQWRCDKQNDCLDGSDEQNCPTHSTTSTCPPTSFTCDNHMCIPKDWVCDTDNDCSDGSD
EKNCQASGTCQPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLNCTSSQFKCADGSS
CINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIHG
SDEHNGCVPKTCSPSHFLCDNGNCIYNAWVCDGDNDCRDMSDEKDCPTQPFRCPSLQWQC
PGYSICINLSALCDGVFDCPNGTDESPLCNQDSCSHFNGGCTHQCMQGPFGATCLCPLGY
QLANDTKTCEDVNECDIPGFCSQHCVNMRGSFRCTCDPEYTLESDGRTCKVTASENLLLV
VASRDKIAVDNITAHTHNIYSLVQDVSFVVALDFDSVTGRVFWSDLMQGKTWSVFQNGTD
KRVVHDSGLSLTEMIAVDWIGRNIYWTDYTLETIEVSKIDGSHRTVLISKNVTKPRGLAL
DPRMGDNVMFWSDWGHHPRIERASMDGTMRTVIVQEKIYWPCGLSIDYPNRLIYFMDAYL
DYIEFCDYDGQNRRQVIASDLVLHHPHALTLFEDSVFWTDRGTRQVMQANKWHGRNQSVV
MYSIHQPLGIIAIHPSRQPSSPNPCASATCSHLCLLSAQEPRHYSCACPSGWNLSDDSVN
CVRGDQPFLMSVRENVIFGISLDPEVKSNDAMVPISGIQHGYDVEFDDSEQFIYWVENPG
EIHRVKTDGSNRTVFAPLSLLGSSLGLALDWVSRNIYYTTPASRSIEVLTLRGDTRYGKT
LITNDGTPLGVGFPVGIAVDPARGKLYWSDQGTDSGVPAKIASANMDGTSLKILFTGNME
HLEVVTLDIQEQKLYWAVTSRGVIERGNVDGTERMILVHHLAHPWGLAVHGSFLYYSDEQ
YEVIERVDKSSGSNKVVFRDNIPYLRGLRVYHRRNAADSSNGCSNNPNACQQICLPVPGG
MFSCACASGFKLSPDGRSCSPYNSFMVVSMLPAVRGFSLDLSDHSEAMVPVAGQGRNVLH
ADVDVANGFIYWCDFSSSVRSSNGIRRIKPNGSSFTNIVTYGIGANGIRGVAVDWVAGNL
YFTNAFVYETLIEVIRINTTYRRVLLKVSVDMPRHIVVDPKHRYLFWADYGQKPKIERSF
LDCTNRTVLVSEGIVTPRGLAVDHDTGYIYWVDDSLDIIARIHRDGGESQVVRYGSRYPT
PYGITVFGESIIWVDRNLRKVFQASKQPGNTDPPTVIRDNIKLLRDVTIFDEHVQPLSPA
ELNNNPCLQSNGGCSHFCFALPELPTPKCGCAFGTLQDDGKNCATSREDFLIYSLNNSLR
SLHFDPQDHNLPFQAISVEGTAIALDYDRRNNRIFFTQKLNSIRGQISYVNLYSGASSPT
ILLSNIGVTDGIAFDWINRRIYYSDFSNQTINSMAEDGSNRAVIARVPKPRAIVLDPCRG
YMYWTDWGTNAKIERATLGGNFRVPIVNTSLVWPNGLTLDLETDLLYWADASLQKIERST
LTGSNREVVVSTAFHSFGLTVYGQYIYWTDFYTKKIYRANKYDGSDLISMTTRLPTQPSG
ISTVVKTQQQQCSNPCDQFNGGCSHICAPGPNGAECQCPHEGSWYLANDDKYCVVDTGAR
CSQFQFTCLNGRCITQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTCANGRCVPYHYR
CDFYNDCGDNSDEAGCLFRSCNSSTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNCPP
HTCQSDFAKCQTTNICVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCVSPQRCIP
SYWFCDGEADCADSSDEPDTCGHSMNSCSASQFHCDNGRCISSSWVCDGDNDCGDMSDED
QRHHCELQNCSSTQFTCVNSRPPSRRCIPQHWVCDGDADCADALDELQNCTMRTCSAGEF
SCANGRCIRQSFRCDRRNDCGDYSDERGCSYPPCRDDQFTCQNGRCITRFFVCDEDNDCG
DGSDEQEHLCHTPEPTCPPHQFRCDNGHCIEMGRVCNHVDDCSDNSDEKGCGINECQDSS
ISHCDHNCTDTITSFYCSCLPGYKLMSDKRTCVDIDECKESPQLCSQKCENVIGSYICKC
APGYIREPDGKSCRQNSNLEPYLIFSNRYYIRNLTTDGTSYSLILQGLGNVVALDFDRVE
KRLYWIDAEKQIIERMFLNKTNRETIISHRLRRAESLAVDWVSRKLYWLDAILDCLFVSD
LEGRQRRMLAQHCVDANNTFCFENPRGIVLHPQRGHVYWADWGDRAYIGRIGMDGTNKTV
IISTKIEWPNAITIDYTNDLLYWADAHLGYIEFSDLEGHHRHTVYDGSLPHPFALTIFED
TVFWTDWNTRTVEKGNKYDGSGRVVLVNTTHKPFDIHVLHPYRQPIMSNPCATNNGGCSH
LCLIKAGGRGFTCECPDDFQTVQLRDRTLCMPMCSSTQFLCGNNEKCIPIWWKCDGQKDC
SDGSDEPDLCPHRFCRLGQFQCWDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANE
WQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCNNGRCIPQSWKCDVDN
DCGDYSDEPIHECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGCESVP
CHPSGDFRCGNHHCIPLRWKCDGIDDCGDNTDEENCVPRECTESEFRCADQQCIPSRWVC
DQENDCGDNSDERDCEMKTCHPEHFQCTSGHCVPKALACDGRADCLDASDESACPTRFPN
GTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPHRFRCDNSRCIY
GHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSD
ETGCNLGENRTCAEKICEQNCTQLSNGGFICSCRPGFKPSTLDKNSCQDINECEEFGICP
QSCRNSKGSYECFCVDGFKSMSTHYGERCAADGNPPLLLLPENVRIRKYNISSEKFSEYL
EEEEHIQAIDYDWDPEGIGLSVVYYTVLAQGSQFGAIKRAYIPDFESGSNNPVREVDLGL
KYLMQPDGLAVDWVGRHIYWSDAKSQRIEVATLDGRYRKWLITTQLDQPAAIVVNPKLGL
MFWTDQGKQPKIETAWMNGEHRHVLASENLGWPNGLSIDYLNDDRIYWSDSKEDVIESIK
YDGTDRRLIINEAMKPFSLDIFEDQLYWVAKEKGEVWRQNKFGKGNKEKVLVVNPWLTQV
RIFHQLRYNQSVSNPCKQVCSHLCLLRPGGYSCACPQGSDFVTGSTVECDAASELPITMP
PPCRCMHGGSCYFDENELPKCKCPGGYSGEYCEIGLSRGIPPGTTMAVLLTFVMVIIVGA
LVLVGFFHYRKTGSILPTLPKLPSLSSLAKPSENGNGVTFRSGADVNMDIGVSPFGPETI
IDRSMAMNEHFVMEVGKQPVIFENPMYAAKDSTSKVGLAAQGPSVSSQVTVPENVENQNY
GRPLEPSEIVPEPTPASPGADETQGTKWNIFKRKPKQTTNFENPIYAEMDTEQKEAVAMA
PPPSPSLPAKASKRSSTPGYTATEDTFKDTANLVKEDSDV
NT seq 13983 nt   +upstreamnt  +downstreamnt
atggagcgcggggccgccgcggcggcatggatgctgctgctggcgattgctgcctgcctg
gcgccagtcagtggccaagaatgtggcagtgggagttttcgctgtgacaatggatactgt
atccctgcatcctggaggtgtgatgggaccagagactgtttggatgacaccgatgaaatt
ggctgtcctcccaggtcctgtgcatcaggttttttcctgtgtcctgctgagggcacctgc
atccctaactcctgggtgtgtgaccaggataaggattgttccgatggtgcagatgaacag
caaaattgccctgggaccacgtgctcaagtcagcagctgacatgctccaatggtcagtgt
gttccgatcgagtacaggtgtgaccatgtcagcgactgccccgatggctctgacgagaga
aactgccattatccaacatgtgatcaacttacttgtgccaacggagcctgctataacacg
agtcagaagtgtgaccacaaagttgactgcagagactcctctgacgaagctaactgcact
acgctgtgttcgcaaaaagaattcgaatgtggcagtggagagtgtatccttcgtgcctat
gtctgtgaccacgacaatgactgtgaagataacagcgatgagcacaattgcaactatgac
acctgcggaggccaccagttcacttgctccaatggccagtgcattaaccagaactgggtt
tgtgacggggatgatgattgccaggattctggtgatgaggatggatgtgaaagtaaccaa
cgtcatcatacgtgttacccaagagaatgggcgtgtcctgggtctgggcgatgcatctca
atggataaagtctgcgatggagttcccgactgtccagaaggaggagatgagaacaatgcc
acaagtggacgacactgtggtacgggtctctgctctatcttaaactgtgagtaccaatgc
tatcagacgccttatggaggagaatgcttctgcccgtcgggtcatatcatcaacagcaat
gacagccgtacttgcatcaatttcgatgactgccagatatggggaatttgtgaccagaag
tgtgaaaaccgacagggccgtcaccagtgcctctgtgaagaaggttatatcctggagcgt
ggacagcattgcaaatccaacaactccttcagtgcggcctccattatcttctctaatggt
cgggatttgctagttggagatcttcacggaagaaacttccggattctagcggagtctaag
aaccgtggaatagttatgggagtggattttcactatcagaagcacagagttttttggaca
gaccccatgcagtcgaaggttttttccactgacattaatggcttaaatacccaagaaatt
cttaatgtttctgttgatgctccagagaatctggctgtggactggattaataataaactt
tatctggtagagacaagagtcaaccgcattgatgtggtcaacttggagggaaatcagcgt
gttactctcataactgaaaacctagggcatcctagaggaattgcccttgatccaactgtg
ggctatttgtttttctcagattggggaagcctctctgggcaacccaaggtggagagagcc
ttcatggatggtagcaatcggaaagacctggtaacgaccaaattggggtggcctgctggg
atcactctggatctggtgtccaagcgagtttactgggtggactctcgttatgactacatt
gaaactgtaacgtatgatggaattcaaaggaagacggtagctcgtggaggctccctcgtc
ccgcatccctttggaataaccttatttgaggaacacgtgttctttactgattggacaaag
atggctgtgatgaaggcaaacaagttcacagaaaccaaccctcaagtgtaccaccagtct
tccctgacacctttcggagtgacagtttaccatgccctcaggcagcccaatgccaccaat
ccgtgcggaagcaacaacgggggctgtgcgcagatctgtgtcctcagtcacaggacggat
aatggcggcctgggctaccggtgcaagtgtgaatttggctttgaactggacgctgatgag
caccactgtgttgccgttaagaacttcctgctcttctcatcacaaacggctgtgcgtggg
atcccattcaccctctctacccaggaagatgtcatggttcctgtcacagggagtccttcc
ttctttgttggaattgactttgatgctcaacacagtaccatcttctattcagatttgtcg
aaagacataatttataaacaaaaaattgatggcacaggaaaagaagtcctcacagcaaac
aggttggaaaatgttgagtgtctgagctttgactggatctcgaggaatctctactggaca
gatggagggttgaagagtgtcacggtcatgaagctggctgataagtcccgacgacagata
atcagcaacttaaacaaccctcgctccattgtggtgcatcccactgctgggtatatgttc
ctgagtgattggttccgtcctgcaaaaattatgagagcatggagcgatggatctcaccta
atgcccatagtcaacactagtctggggtggcccaatggcttggccatcgattggagtgct
tcccggttgtactgggtggatgccttttttgataagattgagcacagcaaccttgatggt
ttagacagaaaaagactgggccacgtagaccagatgacacatccgtttggactcaccgtt
tttaaagataatgtgttcttaacagactggagactgggtgcgattattcgggtcaggaag
tctgatggaggtgatatgacaattgttcgaagtggcatcagcagcataatgcacgtgaaa
gcgtacgatgccgacctgcagaccgggtctaacttctgcagtcagaccacccatcccaac
ggcgactgcagccatttctgcttcccagttccaaacttccagcgggtctgtggctgcccc
tatggaatgaagcttcagagggaccaaatgacttgtgagggagacccagcccgagagcca
cccacacagcagtgtggctccttctcctttccctgcaacaatggcaagtgtgtgcccagt
atcttccgctgtgatggggtggatgattgccatgacaacagtgatgagcatcagtgtggg
gctcttaataacacctgctcatcttcggcttttacctgtgcccacggtggacagtgcatc
cctggccagtggcgctgtgacaaacagaacgactgtttagatggcagtgatgagcaaaac
tgccccactcattcgacgacgtctacttgcccgcccacctccttcacctgcgacaaccac
atgtgtatcccaaaagactgggtctgtgacacagacaatgactgctcagatggatcagat
gaaaagaactgccaagcttcggggacctgccagcctacccagtttcgttgccctgaccac
cggtgtatcagcccgctgtatgtctgtgatggggacaaggactgtgttgatggctcggat
gaggcaggctgtgtgttaaactgcacgagctctcagttcaaatgtgctgatgggagttct
tgcattaacagcaggtaccgctgtgatggggtgtatgattgcaaggacaactctgatgag
gcgggctgtccgaccaggcctcctggtatgtgccacccggatgagtttcagtgccaggga
gatggtacctgcatccctaacacctgggagtgtgacgggcacccagactgtatccacggc
tcggatgagcacaacggctgtgttcctaagacctgctccccgtctcatttcctctgtgac
aatggaaactgcatctacaacgcctgggtctgtgatggggacaatgattgcagggacatg
agtgatgagaaggactgtcctacccagccttttcgctgtcctagcttgcagtggcagtgc
ccaggctacagcatctgtatcaatctgagtgccctgtgtgacggcgtctttgactgtccc
aatgggactgatgagtccccgctttgcaatcaagacagctgctcacattttaatggtggc
tgtactcaccagtgcatgcaagggcccttcggagccacctgcctgtgtccattgggctac
caacttgccaatgataccaagacctgtgaagatgtaaatgagtgtgatattccaggcttt
tgcagccagcactgtgtcaacatgagagggtccttccggtgcacttgcgacccagaatat
acgttggaaagtgatgggcggacttgcaaagtcacagcatctgaaaatctgctgttagtt
gtagcaagccgtgacaaaatcgctgtggacaatatcactgcccacacgcacaacatctat
tctttggtccaggatgtttcttttgtggtggctctggattttgattcagtcactggtcgt
gtcttttggagtgacttaatgcagggtaaaacctggagtgtctttcaaaatggaaccgac
aagagagtggtccatgacagtggcctctctttgacagaaatgattgcagtagactggatt
ggtcgcaacatttactggacagactatactcttgaaacaatcgaagtctctaaaattgat
ggaagtcacaggacagtactgatcagcaaaaatgtcacaaaacctaggggactcgcatta
gatcccagaatgggtgacaatgtaatgttttggtctgactggggtcatcaccctcgaatt
gagcgggccagcatggacggcaccatgcgcacagtcattgtccaggaaaagatctactgg
ccatgtggcttaagtattgactaccccaaccgcctcatctacttcatggatgcctatctt
gattacattgaattctgtgattatgatggacagaaccgaaggcaggtcattgctagcgat
ttggttctccaccatccgcatgcacttactctgtttgaagactctgtgttctggactgac
cgtggtactcgccaggtcatgcaggccaacaagtggcacgggaggaaccagtctgttgta
atgtacagcattcaccaaccgctcggaataattgccattcatccctccaggcaaccatct
tccccgaatccatgtgcctctgccacttgcagccatctttgcctgctttctgcacaggag
cctagacattattcttgtgcttgtccctcgggatggaacctttctgatgattctgtcaac
tgcgtgagaggtgatcaacctttcttgatgtctgtaagagaaaatgtaatttttggaatc
tcccttgatcccgaggtgaagagcaacgatgccatggtccccatatcggggatacaacat
ggttatgatgttgaattcgatgactcagagcagttcatctattgggttgagaatccgggt
gaaattcacagagtgaagaccgacggcagcaacaggacagtgtttgctcctctgtctctg
ctgggctcttctttgggcctggccttggactgggtatcaagaaacatttattataccact
cctgcaagtcggtccattgaggtgttgacactccggggagatacgagatatgggaaaacc
ctgattaccaatgatggcactccacttggcgttggtttccccgttggcatagctgttgat
cctgcacgtgggaaactctattggtcagaccaagggacggacagtggggttcctgccaag
atcgcaagtgctaacatggatggaacatctttaaaaattctcttcactgggaacatggaa
catctggaggttgtcaccctcgacatccaggagcagaagctctactgggcagtcaccagc
agaggcgtgatcgaaagagggaatgtggacggtacagagagaatgatcctggtgcaccac
ctggcccacccgtggggtcttgcggtccatggctccttcctttattattctgatgagcag
tatgaggtcattgaaagagttgacaagtcctctgggagtaacaaagtcgtcttcagagat
aacattccatacctgaggggtctccgggtttaccaccgtcgcaatgctgctgactcttcc
aatggctgtagcaacaacccaaatgcttgccagcagatctgcctgcccgtaccaggtgga
atgttctcttgcgcctgtgccagtgggttcaagctcagccccgacggtcgctcctgttct
ccatataactctttcatggtcgtttccatgctgcctgcagttagaggcttcagcttggac
ttgtctgatcactcagaggccatggtgccagtggctggccaaggacggaatgttctgcat
gcggacgtggatgttgccaacggctttatttactggtgtgattttagcagctcagtgaga
tcctctaacggaattcgtagaatcaaacccaacgggtctagttttaccaacattgttacc
tacggcatcggagcgaatggaatccggggtgtggcagtggactgggtagcagggaatctt
tatttcaccaatgcctttgtgtatgagacactaatagaagtgatacggatcaataccaca
taccgccgtgtcctcctcaaagtctcagtggatatgcccaggcatattgttgttgacccc
aagcatagatatctcttctgggctgactatgggcagaagccgaagattgaacgctctttt
cttgactgtaccaatcgaactgtacttgtctccgaaggcattgtcacccctcggggcctg
gcagtggaccacgacactggctatatttattgggttgacgattccttagatataattgcc
aggatccatcgtgacggaggagaatcccaagtggttcgttatggcagtcgttacccaact
ccttatggcatcactgtctttggagagtcgatcatttgggtggatagaaacttgagaaaa
gtcttccaggccagcaagcaacccgggaatacagacccaccaacagtgataagagataat
attaagttgctacgggatgtgaccatctttgatgagcatgtccagcccctctcaccggca
gagcttaacaataacccttgtttgcaaagcaatggtgggtgttcccacttttgctttgcc
ttacctgagttgcctaccccgaaatgtggatgtgcttttgggactctgcaagatgatggc
aagaactgtgctacttcccgagaagatttcctcatctattccttaaataattccttgaga
agtttacactttgaccctcaagaccataacctgcctttccaagcgataagtgtggaagga
acggccattgcactggactatgatcgcagaaataataggatcttcttcacacaaaagtta
aactctatccgtggccagatttcctatgtcaacctgtactcaggggccagctctccaact
atcctgctgtcaaatataggggttactgatggcattgcctttgactggataaacagaaga
atttactacagcgacttttcaaatcagacaataaattccatggctgaagatggatctaat
cgcgctgtgatcgcccgtgttcccaaaccaagagctattgtattagatccttgccgaggg
tacatgtattggactgactggggtaccaatgccaaaattgaaagagccacactgggagga
aacttccgggtccccattgtgaacaccagcctggtttggcccaatggactcactctggac
ctcgagactgacctcctctactgggcggatgctagcctgcagaaaatagagcgcagtact
ctcactggctcgaaccgagaagtcgtcgtcagtacagccttccattcctttggcttgact
gtttatggccagtacatttactggacagacttttacaccaaaaaaatctaccgtgctaac
aagtacgatgggtcagacctgatctcaatgaccactcgtttgcccacccagcctagtggc
atttctacagttgtcaagacccagcagcagcagtgtagcaatccttgtgaccagttcaat
ggaggatgcagccatatctgtgctccaggtccaaacggagctgagtgtcagtgtccacac
gaaggcagctggtatctggccaacgatgacaagtactgcgtggtggacacaggtgcccgc
tgtagtcagttccagttcacctgccttaacgggcgttgtatcactcaggattggaaatgt
gacaatgacaacgactgtggtgatggcagtgatgagctgcccacagtgtgtgcctttcac
acgtgccgatcaacagccttcacttgtgccaatgggcgatgtgtgccttaccactatcgc
tgtgatttctacaatgactgcggggacaacagcgacgaggcgggatgcctgttcaggagc
tgcaacagcagcacagagttcacttgcagcaacgggaggtgcatacccctcagttatgtc
tgcaacggcatcaacaactgccatgacaatgacacctcggacgagaaaaactgcccgccc
cacacttgccagtcggacttcgccaaatgccagactacaaatatttgtgttccccgagct
ttcttgtgtgatggagacaatgactgtggagatgggagtgacgagaaccccatttactgc
gcctcacacacatgccgcagcaatgagttccagtgtgtctcccctcagcggtgtattcca
agctattggttctgtgacggggaagccgactgtgcggatagctcggatgaacctgacact
tgtgggcattctatgaacagctgctcagccagtcagttccactgtgataacggcaggtgc
atctcaagtagctgggtctgtgatggtgataatgactgcggagacatgagtgacgaggac
cagcgacatcactgtgagcttcagaactgttccagtactcagtttacctgtgtaaatagc
agacctcccagcaggaggtgcattccacaacactgggtctgtgacggtgacgcggactgc
gcggatgccctcgatgagctgcagaactgcaccatgagaacttgctctgccggagagttc
agctgtgcaaatggacggtgtatcaggcagtcattcaggtgtgatcggcgcaacgactgc
ggagactacagcgatgagaggggctgctcgtacccaccatgccgtgatgatcaatttacc
tgtcagaacgggcgatgtatcactaggttctttgtctgtgatgaggacaatgactgtgga
gatgggtcggatgaacaggagcacctatgtcacaccccagaacccacatgcccccctcat
cagttccggtgtgacaacgggcactgcatcgagatggggagagtctgtaatcatgtggat
gactgctcagacaacagtgacgagaaaggctgcggcattaatgagtgccaggattcttca
atcagtcactgtgaccacaactgtacagataccataaccagtttctactgctcctgtctt
cctgggtacaagctcatgtctgacaaacgtacttgcgtggacattgacgagtgcaaggag
tcaccccagctctgtagccagaagtgtgagaatgtcataggctcctacatttgtaagtgt
gcccctggctacatccgtgagccagatgggaagagctgccggcagaacagcaacctcgag
ccctacctcatcttcagcaaccgttactacataagaaacttaactacagatggcacgtca
tactccctgattttgcaaggattgggcaatgttgtggccctggactttgacagagtagag
aagaggctgtattggattgatgcagagaaacaaatcatcgagaggatgtttttgaataag
acaaacagggagaccatcataagccacaggttaagacgtgctgaaagtctggctgtagac
tgggtcagcagaaaactctattggttggatgccatcctagattgcctgtttgtctctgac
cttgaaggtcgacaacgcagaatgctagcccagcactgtgtggatgcaaacaataccttc
tgctttgaaaatcccaggggaattgtccttcatcctcaaagagggcatgtctactgggca
gattggggtgatcgagcatacattggaagaattggcatggatggaaccaataagactgtg
attatctctaccaagatcgaatggcccaatgccatcaccattgactacaccaatgatctc
ttgtactgggcagacgctcacctgggttacatcgagttctctgatttggagggtcaccat
cgacacacagtgtatgacggatcactgccccacccctttgctctcaccatttttgaagac
actgtgttttggacagattggaatacacggacggttgaaaagggaaacaaatatgatgga
tcaggtcgagtcgtgctggtgaacacaacgcacaaaccctttgacatccacgtgttacat
ccataccggcagccgattatgagcaacccctgtgctaccaacaacggtggctgttctcac
ctgtgcctcatcaaagcaggagggagaggattcacctgcgagtgtcccgatgacttccag
accgttcagcttcgagacaggacactctgcatgcccatgtgctccagcacgcagttcctg
tgtggcaacaatgaaaagtgtatccccatatggtggaaatgtgatggacagaaagactgc
tctgatggttctgatgaaccagacctgtgtccacaccgcttctgccgtctgggacagttc
cagtgctgggatggtaactgcacgagcccccaggctttatgcaatgctcgccaggattgt
gccgatggctctgatgaagaccgtgttctctgtgaacatcaccggtgtgaagccaacgag
tggcagtgtgccaacaagcgctgcatccctgagtattggcagtgtgactccgtggacgac
tgcctggataactcagatgaagacccttcgcactgtgctagccggacctgcaggcccggt
cagttcaagtgtaacaacggacgctgcatcccgcagagctggaagtgtgacgtagacaat
gattgtggagactattctgatgagcccatccacgaatgcatgactgctgcttacaactgt
gacaaccacacagaattcagctgcaaaactaactaccgctgcatcccgcagtgggcagtg
tgcaatggttttgatgactgcagggacaacagtgacgagcaaggctgtgaatcggtgccg
tgccacccttctggggatttccggtgtggaaatcaccactgcatccctctccgctggaaa
tgcgacggcattgacgactgtggagacaacacagatgaggaaaattgtgttcctcgggag
tgcacagagagcgagtttcgatgtgctgatcagcaatgcatcccctctcgatgggtctgt
gaccaagaaaatgactgtggagacaactcggatgaacgggactgtgagatgaagacctgc
caccctgaacactttcagtgtaccagtggccactgtgtacccaaggcgttggcgtgcgat
gggagagcagactgtctggacgcttctgatgagtctgcttgcccgactcgatttcccaat
ggtacctactgcccagctgccatgttcgaatgtaaaaaccacgtgtgcatccagtcattt
tggatctgtgacggagaaaatgactgtgtcgacggctccgatgaggagattcatctgtgc
ttcaatgttccgtgtgaatcaccacaccgtttccggtgtgacaacagtcgctgtatttat
ggccaccagctgtgcaatggtgtggatgactgcggagatggaagcgacgagaaagaagaa
cactgtagaaagccaacgcacaaaccttgcacagacaccgagtacaagtgcagcaatggg
aactgcgtttcgcagcactatgtgtgtgataatgtggacgactgtggagacctttcggac
gaaactggttgcaatctaggagaaaatagaacttgtgctgaaaaaatatgtgaacagaac
tgcacccagttaagcaatggaggatttatctgctcctgtcgacctgggttcaaacctagt
actttggacaaaaattcatgtcaagacatcaatgaatgtgaggagtttggcatctgtccc
cagagctgccgaaacagcaaaggaagttacgaatgtttctgtgttgatggcttcaagtct
atgagcacccactatggagaacgatgtgcagctgatggaaacccccctctcttgctcctg
cctgagaatgtccgtatccggaagtacaatatctcctctgagaagttctcagagtatctg
gaagaggaggaacacatccaagcgattgactacgactgggaccccgagggcataggcctc
agtgttgtatattacactgtgctggcacagggctctcaattcggtgcaatcaaacgtgcc
tacattcccgactttgaatctggtagcaacaatcccgtccgtgaagttgatctgggcctg
aaatatttaatgcagccagatggattagccgtggactgggttggaaggcatatttactgg
tcagatgctaagagtcaacggattgaggtggctacccttgacggaagataccggaagtgg
ctgatcaccacccaactggatcagccggccgccattgttgtgaatcctaagctagggctc
atgttctggaccgaccagggaaaacagcctaaaattgagacagcctggatgaatggggag
caccgccatgttctggcttctgagaaccttggctggccaaatggtctttccatagattac
ctgaatgatgatcggatctattggagtgactccaaagaagatgttattgaaagcataaaa
tatgatgggacggacaggagactcatcataaacgaagcaatgaagcccttcagtctggac
atctttgaagaccagctctactgggtagctaaggaaaagggagaagtgtggagacaaaac
aaatttgggaaagggaacaaagagaaagtgctggtggtgaacccctggctcactcaagtc
cgcatcttccatcaactgagatacaaccagtcagtgtccaacccttgcaagcaggtctgt
agccacctctgcctgctgagaccaggaggctacagctgtgcctgtccccaaggctccgac
ttcgtaactggcagcaccgttgagtgtgatgcagccagtgaactccccatcaccatgcct
cccccatgcaggtgcatgcacggaggaagttgctattttgatgagaatgaactccccaaa
tgcaagtgtcctggcggctacagtggagaatactgtgagattgggctctcgagaggcatc
cctccggggacgacaatggctgttctgttgacattcgtgatggtcatcattgttggggct
ctggtactcgttggattctttcactacaggaaaactggctcgattttacccactctgccc
aagctgccaagcttaagcagccttgccaaaccctctgaaaatgggaacggggtgactttc
agatcaggggctgatgtgaacatggacatcggtgtgtctcctttcggtcctgagacaatt
attgacagatccatggcaatgaatgaacacttcgtcatggaggtaggcaagcaacctgtg
atatttgaaaacccaatgtatgcagccaaggacagtacttccaaagtgggcctggcagcg
caggggccgtcagtaagctcacaggtgactgtaccagaaaatgtggaaaaccagaattat
ggaaggcccctagagccttctgagatagtcccagagccaacgccagcctcccctggagct
gatgaaactcagggcacaaaatggaacatcttcaaacgaaaacccaagcaaacaacgaac
ttcgaaaatccaatctacgcagagatggacactgagcaaaaagaagctgtggccatggct
ccccctccatctccttctcttcctgctaaagcttcaaaaagaagttccactccaggctac
actgccacagaagacacctttaaagacactgcaaatcttgtgaaagaagactctgatgta
tag

KEGG   Mus pahari (shrew mouse): 110327985
Entry
110327985         CDS       T05929                                 

Gene name
Cdon
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110327985 (Cdon)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Ig_4 Ig_6 Pur_ac_phosph_N Receptor_2B4
Other DBs
NCBI-GeneID: 110327985
NCBI-ProteinID: XP_021062966
Ensembl: MGP_PahariEiJ_G0014820
LinkDB
Position
10
AA seq 1255 aa
MHPDLGPLWTLLYVLVILCSSVSSDSAPYFISEPLSAVQKLGRPVVLHCSAKPLTARISW
LHNGKQLDRNTEQIKIHRGTLTILSLNPSLSGCYQCVANNSIGAVVSGPATVSAAALGDF
DSSTMHVITAEEKNTGFIGCRVPESNPKAEVRYKIRGKWLKHSTGNYIILPSGNLQILNV
SSKDKGSYKCAAYNPVTSELKVEPTGRKLLVSRPSSDGFHILHPALSQALAVLPHSPVTL
ECVVSGVPASQVYWLKDGQDAVAGSNWRRLYSHLATASIDPADSGNYSCVVGNKSGDVKH
ITYMVNVLEHASISKGLHDQKVSLGATVHFTCDVHGNPAPNRTWFHNAQPIHPSSRHLTE
GNMLKITAVIMEDSGLYQCVADNGIGFMQSTGRLQIEQDSGQKPVIVTAPASIEVMDGDF
VTLSCNATGVPVPVIHWYGRHGLITSHPSQVLRSKSRKSHLFRPGDLDLEPVYLIMSQAG
SSSLSIQAVTLEHAGKYTCEATNKHGSTQSEAFLTVVPFETNTKAESVTPSEASQNDERD
PRDGSESSLLNLFPVKVHSSGVDLPAEKNASVPDAPSILSPPQTHMPDTYNLVWRAGRDG
GMPINAYFVKYRKLDDGSGTAGSWHTVRVPGSENELHLTELEPSSLYEVLMVARSAVGEG
QPAMLTFRTSKEKMASSKNTQASFPPVGIPKRPVTAEASNSNFGVVLTDSSRHSGVPEAP
DRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRMRTSDWLVAAEDIPPSKLSVEVRS
LEPGSIYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSDTQIM
LKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHTIGHLQPETSYDIKM
QCFNEGGESEFSNVMICETKVKRVPGASEYPVKELSTPPSSSGNAGNVGPATSPARSSDM
LYLIVGCVLGVMVLILMVFIALCLWKSRQQSAIQKYDPPGYLYQGSEVNGQIVEYATLSG
AARINGSVHGGFLSKGSLSNGCSHLHHKGPTGVNGTLSGNINGGLYSAHTSSLTRPCMEF
EHPHHLVNSGGVYTAVPQMDPLECINCRNCRNNNRCFTKTNSPLPVVPVVASYPQDGLEM
KPLSAMKVPACPASTVPDHGQVPEECFKDSVAPTPTQHTCCQDNISDINSDSTEDTAEFN
RGDSSGHSEAEDKVFSWKPLILSPVLEDCGEKTARSPPGPPLDGLSVVLQQAQET
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgcatccagacctcggacccttatggacactgctgtatgttcttgtgattctctgttct
tctgtgagctcagactcggcaccttattttatttctgagccactctctgcagtccagaag
cttggtagacccgtggtcctgcattgctctgctaaaccccttaccgctcgaatctcatgg
ttgcataatggaaaacagttggacagaaacacagaacagataaagattcatcgggggact
ttgaccattctgtctcttaacccttccctttctggttgctaccagtgcgttgccaacaac
agcattggggccgttgtaagtggccctgcaacagtgtccgctgcagctctgggtgatttc
gattcatcaaccatgcacgttattactgcagaagagaaaaacacaggcttcattggttgc
agagtaccagagagtaaccccaaagctgaggtgcgctataagatccggggaaagtggctg
aagcattccacaggaaactacataatccttccctcaggaaatcttcagattctgaatgta
tcctcgaaggataaaggatcctataaatgtgctgcctataaccctgtcaccagtgaactg
aaggttgagcccactggccggaagctccttgtgagtcgtccttcatcagatggctttcac
attcttcaccccgctctttctcaggcattagctgtccttcctcacagccctgtgactttg
gagtgtgtggttagtggggtcccggcctcacaagtatattggctgaaggatgggcaggat
gctgtggcgggaagcaactggagaaggctgtactctcatctggccacagctagcatcgac
ccagcagattcggggaactattcctgtgtggtgggcaacaagtccggagatgtgaaacac
atcacttacatggtcaatgtactggagcacgcatcaatttctaaagggctgcatgatcag
aaggtgtccctgggggccaccgtacattttacctgtgatgttcatgggaacccagccccc
aaccgcacctggtttcataacgcacagcctatccacccctcctcccggcatctaactgaa
ggaaacatgctgaagatcactgccgttatcatggaagattctgggttatatcagtgcgta
gcagacaatggcattggatttatgcagtctactggaagacttcaaattgaacaagacagt
ggacagaaacctgttatagtcactgcaccagcaagcatagaggtgatggacggagacttc
gtgactttgtcttgcaatgccactggagtgcccgtcccagtcattcattggtacggccgc
catggattgataaccagccatccatctcaggtccttaggtccaaatcccgaaagtcccac
ctgttccggcctggggacctggacctggagcctgtctacctcatcatgtcccaagctggc
tcaagctctctgtctattcaggcagtgactctggagcatgctgggaaatacacgtgtgaa
gctacaaacaaacatggcagcacacagtcggaagcattcctcacagttgttcctttcgag
acaaacacaaaggcagagtcggtcacaccttccgaagcgtctcagaatgatgaacgagac
ccacgagacggttcagagtccagcctgctgaacttgtttccagtgaaggtacattccagt
ggagtggacttgccagcagagaaaaatgcctcggtccccgatgctcctagcatactgagc
cccccacagacccacatgccagacacgtacaacctggtgtggcgggcagggagggatggc
gggatgcccatcaacgcctatttcgtgaagtaccgaaagctggacgatggtagtggaaca
gcgggcagctggcacacagttcgtgtcccagggagtgaaaatgagctgcatctaactgag
ctggaaccatcaagtctctatgaagttttgatggtggctagaagcgctgttggtgaagga
cagcctgccatgcttaccttccggaccagcaaagaaaaaatggcatcatcaaaaaacacc
caggcctcctttccacctgtgggcatccctaagcggcctgttactgcagaggcttccaac
agcaattttggagttgtgcttacggattcctctaggcatagtggagtcccagaggcacca
gatcgacctactatctctatggcatcggagacctcagtctatgtcacctggattccccga
gcaaatggtggctctcccatcaccgccttcaaggtggaatataaacggatgagaactagt
gattggctggtagcggctgaagacattcctccttccaaactctctgtggaagttcgtagt
ttagagccaggttcaatatacaaatttagggtcattgctatcaaccattacggtgagagt
tttcggagctcagcatcccgtccttaccaggtggccggcttcccaaatcgtttttccaat
cgcccaataactggacctcacatcgcatacacggaggctgttagcgacactcagatcatg
ctgaaatggacgtatattccatcaagtaacaataacactcccattcaaggattctatatc
tattaccggccaacagacagtgacaatgacagcgattacaagagagacgttgtggaaggt
tcaaagcagtggcacaccattggtcacctgcagccagagacctcctatgacattaagatg
cagtgctttaatgaaggaggggagagtgagttcagcaatgtgatgatctgcgagactaaa
gtgaaacgtgtccctggagcttccgagtatcccgtgaaagagttgagtactcctcccagt
tcttcaggaaacgcagggaatgtggggcctgcaaccagccctgccaggagcagcgatatg
ttgtacctcatcgttggctgtgtgcttggggttatggtcctcattcttatggttttcatt
gcgctgtgtctgtggaagagtcgccaacagagcgccatacagaaatatgatcctccaggc
tatctctaccaggggtcagaggttaatgggcagatagtagagtatgccactctctcagga
gcagcccggatcaatgggagtgttcacggaggcttcctcagcaaaggaagcctcagcaat
ggctgctctcacctgcaccacaagggccctactggtgtcaacgggaccctgagtggaaac
ataaatggaggcctttattctgcacacacaagctccctgaccaggccgtgtatggagttt
gagcatcctcaccatctagtgaatagtggaggagtatacacagccgtccctcagatggac
ccactggaatgcattaattgtcggaattgccggaacaacaataggtgtttcaccaaaacc
aacagtccccttcctgtggtcccagtggtagcctcttatcctcaggatggtctggaaatg
aagcccctcagtgccatgaaggtacctgcgtgtccagcttccacagttcctgaccatggc
caggtacctgaggagtgcttcaaggacagtgtggcaccaacacctacccagcatacttgc
tgccaggacaacataagtgacatcaattctgattccacagaggacacagcagagttcaac
agaggagacagcagtggtcattctgaagcagaggacaaagttttcagttggaagcctctt
attttgtcacctgtcttggaggactgtggcgagaagacagcaaggtctccccctggcccc
cctctagatggattgtcggtggtccttcagcaagcccaagagacctga

KEGG   Mus pahari (shrew mouse): 110329501
Entry
110329501         CDS       T05929                                 

Gene name
Boc
Definition
(RefSeq) LOW QUALITY PROTEIN: brother of CDO
  KO
K20020  brother of CDO
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110329501 (Boc)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110329501 (Boc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 ISET-FN3_linker V-set Ig_4 C2-set_2 Ig_5 Pur_ac_phosph_N C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 110329501
NCBI-ProteinID: XP_021064779
Ensembl: MGP_PahariEiJ_G0016468
LinkDB
Position
12
AA seq 1096 aa
MTMCQGERPMLTLLWIFVATAGCLPDLNEVPQVTVQPTSTVQKLGGTVILGCVVEPPWVN
VTWRFNGKELNGSDDVLGVFITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLA
NLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGNL
QIVNASQEDEGMYKCAAYNPVTQEVKTSGSGDRLRVRRSTAEAARIIYPLEAQTVIVTKG
QSLILECVASGIPPPRVTWAKDGSSIAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGV
GDPGAAVILYNVQVFEPPEVTVELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNAVPLTS
SQRLRLSRRALRVVSVRPEDEGVYQCMAENAVGSAHAVVQLRTARPDTTLRPGRDTKPIA
ATPPMLPSRPSRPDQMLREQPGLVKPPTSVQPTSLKCPGEEQVAPAEAPIILSSPRTSKT
DSYELVWRPRHEGSSRTPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLDPGSLYE
VEMAAYNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGASLQSSSQPDHGRLSPP
EAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLSV
EITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITFTDAVNE
TTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKFSGQPGRPPPLTLAPPQPPLRKSILRLLDSHLP
VCRSDTMSVGLYPAVGGXVALCVLFFXEHTTDLGFPQSALLSSSCQYTMVPLGGLPGHQA
NGQPYLGGVSGRACVSRVHGSRGCPAATAGCPGRKPQHCPGELAQREDTNSLRSQPIVSN
GYDLQNQQVARGPQSASEGGAFLYTLPDDSTHQLLQPQDCCHLQKQPVTTCQTAVRPTSE
SPGLEVSWDPPYHSGSRGCLGLVPVEEVDSSDSCQVGGGDWCPQHPSGTYTGQELGMRFS
PRPPVHVSFETPPPTI
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgacgatgtgccaaggagagcggcctatgcttacactgctttggattttcgtggccaca
gcaggctgccttcctgatttgaatgaggttcctcaggtcaccgtccagcccacgtccact
gtccagaagctgggaggaactgtgatcctgggctgtgtggtggagccaccatgggtgaac
gtgacttggcgcttcaacgggaaggagctaaatggctctgatgatgttctgggtgtcttc
atcacccgtgggacccttgttattgctgccctcaacaaccacactgtgggacggtaccag
tgtgtggctcggatgcctgcgggagctgtggccagtgtgccagccacggtgacactagcc
aatctccaggactttaaattagatgtgcaacatgtgatcgaagtagacgaggggaacaca
gccgtcattgcctgccacctgcctgagagccacccaaaagcccaggtccggtacagtgtc
aaacaggagtggctggaggcctctagagacaactacctgatcatgccatcggggaatctc
caaattgtcaatgccagccaggaggacgaaggcatgtacaagtgtgccgcctacaacccg
gtgacccaggaagtgaaaacctccggctccggcgacaggctgcgcgtgcgccgctccacc
gctgaggctgcccgcatcatctacccactggaagcccagaccgtcattgtcaccaaaggc
cagagtctcatactagagtgtgtggccagtgggatcccgccacctcgagtcacgtgggcc
aaggatgggtccagcattgctgcctataacaagactcgcttcctgctgagtaacttgctt
attgacaccaccagcgaggaggactcaggcacctaccgatgtatggccagcaatggggtt
ggggatcccggggcagctgtcatcctctacaacgtccaggtgtttgaaccccctgaggtc
acagtggagctgtcccaactggtcatcccatggggccagagtgcaaagctcacctgtgag
gttcgaggaaaccccccaccttctgtcctatggctgaggaatgcggtgcccctcacctcc
agccagcgcctccggctgtcacgcagagccctgcgggtggtcagtgtcaggcctgaggac
gaaggcgtgtaccagtgcatggctgagaatgcggttggcagtgcccacgctgtggtccaa
ctgaggaccgctcggccagacacaaccctgagacccgggagggataccaagccgattgct
gccacaccccccatgctaccctccagacccagcagacctgaccagatgcttcgggaacag
ccgggacttgttaagcccccaacatcggtacaacctacttccctgaagtgcccgggagag
gaacaagtagcccctgcagaggcacctatcatcctcagctcaccccggacctccaagaca
gattcgtacgagctggtgtggcggcctcgccatgaggggagcagccggacacccatcctg
tactacgtagtgaagcatcgtaaggtcacgaactcctctgatgactggaccatttctggc
attccagccaaccagcaccgcctcaccctgaccaggcttgaccccggaagcttgtacgaa
gtggagatggcagcctacaactgtgctggcgagggccagacagctatggtcaccttccga
acaggacggcggcccaaaccggagatcgtggccagcaaggagcagcagatccagagagat
gaccctggtgccagtctccagagcagcagccagcctgaccacggccgcctctccccccca
gaagctccagacagacccaccatctccacagcttctgagacctccgtgtatgtgacctgg
attccccgagggaacggtggcttcccaattcagtctttccgtgtagagtacaagaagctg
aaaaaagtgggagactggatactggctaccagtgccatacctccctcgaggctctctgtg
gagatcacaggcctggagaaaggcatttcttacaagttccgagtccgtgctttgaacatg
ctaggggagagtgaacccagcgctccctcccggccctatgtggtgtcaggctacagtggc
cgtgtatatgagaggcccgtggcaggtccttacatcaccttcaccgacgcagtcaatgag
accactattatgctcaagtggatgtatatccccgccagcaacaacaacaccccaatccat
ggcttctatatctactaccgacccacagacagtgacaatgacagtgattacaagaaggac
atggtggaaggggacaggtactggcactctatcagccacctgcagccagagacttcctat
gacattaaaatgcagtgcttcaatgaaggaggggagagcgagttcagcaatgtcatgatc
tgcgagaccaaagctcggaaattctctggtcagcctgggagacccccacccttgactcta
gctccaccacagcctccacttagaaaaagtattctcaggctgttggacagtcacctccct
gtctgtcgctctgacactatgagtgtggggctttatccagctgtaggaggctaagtagcc
ctctgtgttctgttcttcncagagcatacaacagacctgggttttcctcagagtgccctc
ctgtcttcctcctgccagtacacaatggtgccattggggggacttccaggtcaccaagcc
aatgggcagccctacctcggtggcgtcagtggacgggcctgtgtcagccgagtgcacgga
agcaggggctgccccgctgctacagcgggctgcccaggcaggaagcctcagcactgccca
ggggagcttgcccagcgggaagacaccaacagcctacggagtcagcccattgttagcaat
ggatatgacctccagaaccagcaggttgccagaggtccccagtccgcctcagaaggaggt
gctttcttatacacgctgcctgatgattcaactcaccagctgctccaacctcaagactgc
tgtcacctccagaagcaacctgtcaccacgtgccaaacagcagtgaggccaacatctgaa
agtcctggactagaagtgtcatgggaccctccctatcattcagggtcccggggctgttta
ggtcttgtaccagttgaagaagtggacagttctgactcctgccaagtgggtggaggagac
tggtgtccccagcacccttcagggacctacacaggacaggagcttgggatgcggttctcg
ccccgcccaccagttcatgtgtcctttgaaacaccacctcccacaatttag

KEGG   Mus pahari (shrew mouse): 110334027
Entry
110334027         CDS       T05929                                 

Gene name
Gas1
Definition
(RefSeq) growth arrest-specific protein 1
  KO
K06232  growth arrest-specific 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110334027 (Gas1)
SSDB
Motif
Pfam: GDNF DUF1380
Other DBs
NCBI-GeneID: 110334027
NCBI-ProteinID: XP_021071511
Ensembl: MGP_PahariEiJ_G0019677
LinkDB
Position
16
AA seq 344 aa
MLAALLGGAGARTGTLPGALLCLMALLQLLCSAPRGSGLAHGRRLICWQALLQCQGEPDC
SYAYSQYAEACAPVLAQRGGADAPGPAGAFPASAASFSPRWRCPSHCISALIQLNHTRRG
PALEDCDCAQDEHCRSTKRAIEPCLPRTSSVGPGAGAGSVMGCTEARRRCDRDSRCNLAL
NRYLAYCGKLFNGLRCTDECRAVIEDMLAVPKAALLNDCVCDGLERPICESVKENMARLC
FGPDASNGPGSSGSDGGLDDYYDEEYDDEQRAGAAGGEQPLDDDDGLARPGGGAAAAGGR
GDLPHGPGRRSSSSGSGGHWATRSAWTPFACLLLLLLLLLGSHL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgctagccgcgctgctgggcggcgccggggcccgcacggggaccttgccgggcgccttg
ctgtgtctgatggcgctgctgcagctgctgtgctcagcaccgaggggctcggggctagcg
cacggccgccgcctcatctgctggcaggcactgctgcagtgtcagggcgagcccgactgc
agctacgcctacagccagtacgccgaggcttgtgcgccggtgctagcgcagcgcggcggg
gctgatgctccggggcccgccggcgccttccccgcctcggccgcgtccttctcgccgcgc
tggcgctgcccgagccactgcatctcggcgcttatccagctcaaccacacgcgccgcggg
cccgcgctggaggactgcgactgcgcgcaggacgaacactgcaggtccaccaagcgcgcc
atcgagccctgtctgccgcgcaccagcagcgtgggcccgggcgcgggagcgggctcggtc
atgggctgcactgaggcccggcggcgctgcgaccgggacagccgctgcaacctggcgctc
aaccgctacctggcctactgcggcaagcttttcaacgggctgcgctgcaccgacgagtgc
cgagcggtcatcgaggacatgctggccgtgcccaaggcggcgctgctcaacgactgcgtg
tgcgatgggctggagcggcccatctgcgagtcggtcaaggagaacatggcccgcctgtgc
ttcggcccagatgcgagcaacggtccggggagcagcggctcggacgggggcctggacgac
tattacgacgaagaatatgacgacgagcagcgcgctggggccgcgggcggcgagcagccc
ctggacgacgacgacggccttgcgcgcccgggcggcggcgctgctgcggcgggaggccgc
ggagacttgccccacgggcccgggcgcaggagcagcagcagcggcagtggaggccactgg
gcgacccgaagcgcctggaccccgtttgcctgtttgctgctcctgttgctcctgttgctc
gggtcacacttgtag

DBGET integrated database retrieval system