KEGG   Mus pahari (shrew mouse): 110318578
Entry
110318578         CDS       T05929                                 

Symbol
E2f1
Name
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04110  Cell cycle
mpah04137  Mitophagy - animal
mpah04218  Cellular senescence
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110318578 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    110318578 (E2f1)
   04218 Cellular senescence
    110318578 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318578 (E2f1)
   05206 MicroRNAs in cancer
    110318578 (E2f1)
   05207 Chemical carcinogenesis - receptor activation
    110318578 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110318578 (E2f1)
   05225 Hepatocellular carcinoma
    110318578 (E2f1)
   05226 Gastric cancer
    110318578 (E2f1)
   05214 Glioma
    110318578 (E2f1)
   05220 Chronic myeloid leukemia
    110318578 (E2f1)
   05218 Melanoma
    110318578 (E2f1)
   05219 Bladder cancer
    110318578 (E2f1)
   05215 Prostate cancer
    110318578 (E2f1)
   05224 Breast cancer
    110318578 (E2f1)
   05222 Small cell lung cancer
    110318578 (E2f1)
   05223 Non-small cell lung cancer
    110318578 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110318578 (E2f1)
   05161 Hepatitis B
    110318578 (E2f1)
   05160 Hepatitis C
    110318578 (E2f1)
   05163 Human cytomegalovirus infection
    110318578 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110318578 (E2f1)
   05169 Epstein-Barr virus infection
    110318578 (E2f1)
   05165 Human papillomavirus infection
    110318578 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110318578 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110318578 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110318578 (E2f1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110318578 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 110318578
NCBI-ProteinID: XP_021049398
Ensembl: MGP_PahariEiJ_G0025957
LinkDB
Position
3
AA seq 433 aa
MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQLPAGPAAPPTGPRDPD
VLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSP
GEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAK
KSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDTQR
LAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEES
AEGINPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPGQSPLGLEQEAVLPRMGN
LRAPMEEDRLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHETLDYHFGLEESEGIRDL
FDCDFGDLTPLDF
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggccgtagctcccgcgggcggccagcacgcgccagcgctggaggccctgctcggggcg
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctaccgcgcccgatgtc
ggcgccccgcagctccccgccggccccgccgcgccgcccaccggccctcgcgatcctgac
gtgctgctcttcgccacgccgcaggcgccccgacccgcgcctagtgcaccgcgcccggct
ctcggccgcccgccggtgaaacggaggctggacctggaaactgaccatcaatacctggct
ggcagcagtgggccattccggggcagaggccgccacccagggaaaggtgtgaagtctcca
ggggagaagtcacgctatgagacctcactaaacctgaccaccaagcgcttcttggagctg
ctgagccgctcagcagatggtgtcgttgacctgaactgggcagctgaggtgctgaaggtg
cagaaacggcgcatctatgacatcaccaatgtcctggagggcatccagctcattgccaag
aagtccaagaatcatatccagtggctaggcagccacaccatggtggggattggtaagcgg
cttgaaggcctgacccaggacctgcagcaactgcaggagagtgagcagcagctggatcac
ctgatgcacatctgtaccacacagctgcaactgctttccgaggactccgacacccagcgc
ctggcctatgtgacctgccaggaccttcgcagcatcgcggaccctgcagaacagatggtc
atagtgatcaaggcccctcctgagacccagctgcaagctgtggattcttcagagacgttt
cagatctcgcttaagagcaaacaaggccccatcgatgttttcctgtgtcctgaggagagt
gcagaggggattaaccctgggaagacctcatgccaggagacatcctctggggaggacagg
actgcagactctggccctgcagggcctccaccatcacctccctccacatccccagccttg
gatcccggtcaatccccgttaggcttggagcaagaagcagtattgccacgaatgggcaac
ctgagggcccccatggaagaggaccgactgtcaccactggtggctgctgactcactcctg
gagcatgttaaagaagacttctctgggctcctccctggggagttcatcagcctttcccca
ccccatgagacccttgactatcactttggtctcgaggagagtgagggcattagagatctc
tttgactgtgactttggggacctgactcctctggatttctga

KEGG   Mus pahari (shrew mouse): 110323461
Entry
110323461         CDS       T05929                                 

Symbol
E2f2
Name
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04110  Cell cycle
mpah04218  Cellular senescence
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110323461 (E2f2)
   04218 Cellular senescence
    110323461 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323461 (E2f2)
   05206 MicroRNAs in cancer
    110323461 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110323461 (E2f2)
   05225 Hepatocellular carcinoma
    110323461 (E2f2)
   05226 Gastric cancer
    110323461 (E2f2)
   05214 Glioma
    110323461 (E2f2)
   05220 Chronic myeloid leukemia
    110323461 (E2f2)
   05218 Melanoma
    110323461 (E2f2)
   05219 Bladder cancer
    110323461 (E2f2)
   05215 Prostate cancer
    110323461 (E2f2)
   05224 Breast cancer
    110323461 (E2f2)
   05222 Small cell lung cancer
    110323461 (E2f2)
   05223 Non-small cell lung cancer
    110323461 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110323461 (E2f2)
   05161 Hepatitis B
    110323461 (E2f2)
   05160 Hepatitis C
    110323461 (E2f2)
   05163 Human cytomegalovirus infection
    110323461 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323461 (E2f2)
   05169 Epstein-Barr virus infection
    110323461 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110323461 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110323461 (E2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110323461 (E2f2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110323461 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110323461
NCBI-ProteinID: XP_021056351
Ensembl: MGP_PahariEiJ_G0028989
LinkDB
Position
6
AA seq 443 aa
MLRAPRTLAPATVQPTKSLPALNPTELWPSGLSSPQLCPATTATTYYTSLYTQTVPSSAA
LGTCLDATPHGPEGQIVRCVPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSP
KTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEG
IQLIRKKSKNNIQWVGRGLLEDPTRPSRQQQLGQELKELMNAEQTLDQLIQSCSLSFKHL
TEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGPI
EVYLCPEEGQEPDSPAKEALPSTSTLSPVPDCAQPGCSTDSGIEETIESSVLIPQPVPPP
PPPPLPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSPILAANSPLISFSPPLDQDEYLW
GMDEGEGISDLFDSYDLGDLLIN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctgcgcgcgccgcggaccctggctccggccacggtgcaacctacaaagagcttgccg
gcgctgaaccccaccgagctgtggccttcgggtctgagcagcccccagctctgcccggcc
accaccgccaccacctactacacttcgctttacacgcagacggtgccttcctctgcggcg
ctgggcacctgcctcgacgccactccccacggacccgagggccaaattgtgcgatgtgta
cccgcaggccggctgccggccaaaaggaagttggacctggagggcattgggaggcctacg
gtccctgaattccggacccccaaggggaagtgcatccgcgtggatggtttgccaagcccc
aaaacccccaagtctcctggggagaagacacgctacgacacgtcgctggggctgctgacc
aagaagttcatttacctcctgagcgagtcggaggatggagtcctggacctgaactgggca
gcggaggtgctggatgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggt
atccagctcatccgcaagaagtccaaaaacaacatccagtgggtaggcaggggactactt
gaagaccccacccgaccctccaggcagcagcagttagggcaggagctgaaggagctgatg
aatgcggagcagaccttggaccagctcattcagagttgctcgctgagcttcaagcacctg
accgaagataatgccaacaagaaactggcctatgtgacctaccaggatatccgtgccgta
ggcaacttcaaggagcagaccgtgattgccgtcaaggctccaccacagacaagattggaa
gtgccggacagggcggaggagaacctgcagatttatctaaagagtacccaaggccccatt
gaagtctacctgtgccctgaggaggggcaggagccagacagtcctgccaaggaggctctc
ccttccacctccaccctcagccccgtccctgactgcgctcagcccggctgcagcactgac
tcggggatcgaagagaccatagagtcttcagtactgataccccagccggtaccaccgcca
ccgccaccaccactgccgccagccccatccctcgtccccttggaagccactgacaacatg
ctggagctgtcgcacccacttctacaacagactgaggaccagttcctgtccccaatcctg
gcagccaactcccctctgatcagcttctccccgcccttggaccaggacgaatacctgtgg
ggcatggacgagggggagggcatcagtgaccttttcgactcctatgatcttggggacctg
ttgattaattga

KEGG   Mus pahari (shrew mouse): 110333784
Entry
110333784         CDS       T05929                                 

Symbol
E2f3
Name
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04110  Cell cycle
mpah04218  Cellular senescence
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110333784 (E2f3)
   04218 Cellular senescence
    110333784 (E2f3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333784 (E2f3)
   05206 MicroRNAs in cancer
    110333784 (E2f3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110333784 (E2f3)
   05225 Hepatocellular carcinoma
    110333784 (E2f3)
   05226 Gastric cancer
    110333784 (E2f3)
   05214 Glioma
    110333784 (E2f3)
   05220 Chronic myeloid leukemia
    110333784 (E2f3)
   05218 Melanoma
    110333784 (E2f3)
   05219 Bladder cancer
    110333784 (E2f3)
   05215 Prostate cancer
    110333784 (E2f3)
   05224 Breast cancer
    110333784 (E2f3)
   05222 Small cell lung cancer
    110333784 (E2f3)
   05223 Non-small cell lung cancer
    110333784 (E2f3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110333784 (E2f3)
   05161 Hepatitis B
    110333784 (E2f3)
   05160 Hepatitis C
    110333784 (E2f3)
   05163 Human cytomegalovirus infection
    110333784 (E2f3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110333784 (E2f3)
   05169 Epstein-Barr virus infection
    110333784 (E2f3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110333784 (E2f3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110333784 (E2f3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110333784 (E2f3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110333784 (E2f3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110333784
NCBI-ProteinID: XP_021071153
Ensembl: MGP_PahariEiJ_G0019453
LinkDB
Position
16
AA seq 457 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAPGTYIQILTTN
PSTTSCATSLQSGALTAGPLLPSVPGTEPAASSLYTTPQGPSSRAGLLQQPPAPGRGGGG
GPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTK
KFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSE
DGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKIS
GLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHRPMKTNNQDH
NGNIPKPTSKDLASNNSGHSNCSVSTANLSPLASPANLLQQTEDQIPSNLEGPFVNLLPP
LLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttcgccgccgccgccgccccgggcacgtacatccagatcctcactacgaac
ccttccaccacgtcctgtgccacctccctccaaagcggcgccctgaccgccggccccctt
ctccccagtgtccccggcacggagccggccgccagcagcctctacaccacgccacaagga
ccctccagcagagccgggctgctgcagcagccaccagcaccaggacgcggcggcggcggt
ggcccaccggcaaagcgaaggctggaactgggcgagagtggccatcagtacctctcagat
ggtctaaagacccccaagggcaaaggaagagctgcactacggagtcccgatagtccaaaa
actccaaaatctccctcagaaaaaacgcggtatgatacgtccctcggtctgctcaccaag
aagttcattcagctcctgagccagtcgcctgatggggtcctggatctgaacaaggcagca
gaggtgctcaaggtgcagaagaggaggatttacgacatcaccaacgtgctggaaggcatc
cacctcatcaagaagaagtctaagaacaacgtccagtggatgggctgcagtctctctgag
gatgggggcatgctggcccagtgtcaaggcctgtccaaagaagtgaccgagctcagtcag
gaagagaagaagttagatgagctgatccaaagctgtaccctggacctcaaactgttaacc
gaggattcagagaatcaaaggttagcttatgttacatatcaagatattcgaaaaattagt
ggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacgagacttgaagtg
cctgactcaatagagagcctacaaatccatttggcaagtacccaagggcccattgaggtt
tacctgtgtccagaagagacggaaacacacagacccatgaaaacaaataaccaagaccac
aatgggaatatccctaagcccacttccaaagacttggcttctaacaactcaggacatagt
aactgctcggtttctacagcaaacctctctcctctggcctccccagccaaccttttacag
cagactgaggaccaaatcccttccaaccttgaaggaccttttgtgaacttactgcctccc
ctgctccaagaggactatctgctgagcctgggggaggaagaggggatcagcgatctcttc
gatgcctacgatttggagaagctgcctctggtggaggacttcatgtgtagttga

DBGET integrated database retrieval system