KEGG   Mus pahari (shrew mouse): 110318782
Entry
110318782         CDS       T05929                                 

Gene name
Pard6b
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110318782 (Pard6b)
   04390 Hippo signaling pathway
    110318782 (Pard6b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110318782 (Pard6b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110318782 (Pard6b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110318782 (Pard6b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110318782 (Pard6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110318782 (Pard6b)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110318782 (Pard6b)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110318782
NCBI-ProteinID: XP_021049704
Ensembl: MGP_PahariEiJ_G0026157
LinkDB
Position
3
AA seq 371 aa
MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNVLSNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIED
SGEPQQIPKATPAQSLESLTQIELSFESGQNGFSLSQDTSLVPVPSSLDTELESRAPGQK
LLEEDGTIITL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaaccgcggccaccggcacggggcgagcagcggctgcctgggcaccatggaggtgaag
agcaagtttggagctgagtttcgtcggttttcactggaaagatccaagcctggaaaattt
gaagagttttacggactgctgcagcatgttcacaagatccccaatgtcgacgtgctggtg
ggctacgcagatatccacggggacctgctgcccataaataatgacgacaactaccacaag
gcagtttccaccgccaacccactgctcaggatttttatacagaagaaggaagaagctgac
tacagtgcctttggcaccgacaccctaatcaggaagaagaacgtgctgagcaacgtgctg
cgtcccgacaaccaccggaagaagcctcacatcgtcatcagcatgccacaggactttcgg
cccgtgtcatccatcatcgacgtggacatcctcccggagacccaccggagggtccgtctg
tacaagtatggcacagagaagccgctgggcttctacatccgggatggctccagcgtccgg
gtgacaccgcatggcttggagaaagtccctggcatcttcatatctcggcttgtccccggg
ggtctggcccagagcacgggcctgctagctgtcaatgatgaggtgttagaagtcaatggt
atagaagtgtcagggaagagcctggaccaggtgactgacatgatgatagccaacagccgc
aacctcatcatcaccgtgcgcccggctaaccagaggaacaacgtggtgcgcaacagtcgg
acttctggcagctccagccagtccactgacaacagcctcctgggcttcccacagcaggtg
gaggctagcttcgagcctgaagaccaggacagtgacgaggacgacatcatcattgaagac
agtggcgagccgcagcagatcccgaaggccacccccgcccagagcctggagtccctgacg
cagatcgagctcagctttgagtcgggacagaacgggttctccctttctcaggacacgagc
ctggtgcctgtgcccagcagcctggacacagagctggaaagccgggctccgggccagaaa
ctcttagaggaagatgggacaatcataacgttgtga

KEGG   Mus pahari (shrew mouse): 110333218
Entry
110333218         CDS       T05929                                 

Gene name
Pard6g
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110333218 (Pard6g)
   04390 Hippo signaling pathway
    110333218 (Pard6g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110333218 (Pard6g)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110333218 (Pard6g)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110333218 (Pard6g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110333218 (Pard6g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110333218 (Pard6g)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110333218 (Pard6g)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110333218
NCBI-ProteinID: XP_021070408
Ensembl: MGP_PahariEiJ_G0019159
LinkDB
Position
15
AA seq 382 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYQLVVHTHHISSTEV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEADHYTFGAGTLSRKKKVLVT
LRDEGLRRRPHLNISMPHDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRSSRTSGSSVQSADSTSSHHSLPGTHVLQNSEDVESDEEADIV
IEGALEPQHIPKMQAVPPGSLSRANGTSLAHRLHRGDMSLHSSGRESNGSIHRFLSSLKP
DPRHSLVLPQGGVEEHGPAITL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcataagtctcagaccctacgcttctacgactgtagcgctgtggaa
gtcaagagcaagtttggcgccgagttccgaaggttctccttggatcgccacaagcctggg
aagtttgaagatttctaccagctggtggtgcacacccaccacatctctagcaccgaggtg
accattggctatgccgatgtgcatggggacctgctgcccatcaacaatgacgacaacttc
tgcaaggcggtctcaagcgcaaaccccttgcttcgagtcttcatccagaagcgagaagag
gcagaccattacacctttggagcaggcactctgtcaaggaagaaaaaggtgctggtgacc
ctgagggatgagggtctgcgtcggcgtccccacctcaacatcagcatgccacatgacttc
cgcccagtgtcatccatcatcgatgtggacatcctcccagagacacaccgccgagtgagg
ctctacagacacggctgtgagaagccactgggcttctacattcgagatggcaccagcgtg
cgtgtgacgccccatgggctagaaaaggtcccaggtatcttcatttctcgaatggtgccc
gggggccttgcggagagcactggtctactggctgtgaacgatgaagtcctggaggtgaat
gggattgaggtagctggaaaaacattggatcaagtcacagacatgatgatagccaacagc
cacaacctcattgtcactgtcaagcccgccaaccaaaggaacaatgtggtccgcagcagc
cgcacatctggcagctctgtgcaatccgcagacagcaccagcagtcaccacagcctgcca
ggtacccatgtcctgcagaattctgaggacgtggagagtgacgaggaagccgacattgtc
attgaaggggctctagaacctcaacacattcccaagatgcaggctgtacctccaggtagc
ctctcaagggccaatggcaccagccttgctcacaggctgcacagaggggacatgagcctg
catagctctgggagggagagcaacggcagcatccacagatttctcagctccctgaagcca
gacccccgacacagcttggtcctcccccaaggaggggtggaggaacatgggccagccatt
acgctctag

KEGG   Mus pahari (shrew mouse): 110337228
Entry
110337228         CDS       T05929                                 

Gene name
Pard6a
Definition
(RefSeq) partitioning defective 6 homolog alpha isoform X1
  KO
K06093  partitioning defective protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337228 (Pard6a)
   04390 Hippo signaling pathway
    110337228 (Pard6a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110337228 (Pard6a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110337228 (Pard6a)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110337228 (Pard6a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110337228 (Pard6a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110337228 (Pard6a)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     110337228 (Pard6a)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 110337228
NCBI-ProteinID: XP_021075663
Ensembl: MGP_PahariEiJ_G0023091
LinkDB
Position
20
AA seq 346 aa
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLSGPSSVGPGPTDPDSDDDSSDLVIENRHPPCSNGLSQ
GPLCWDLQPGCLLPGAGSSLPSLESREQANPGWGNGMRGDVSGFSL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggccaggccgcagaggactccggcgcgcagtcctgatagcatcgtggaggtgaagagc
aaatttgacgccgagttccgacgctttgcactaccccgcacttcggtgagaggcttccag
gagttctcgcggttgctgtgtgtggtacaccagattcctggcctggatgtgctgcttggc
tatacggatgcgcacggtgacctgctgcccctcaccaacgatgacagtttgcaccgggcc
ctggccagcgggcccccacctctgcgcctcttggtccagaaacgggcagaaggtgactcg
agtggcctggcttttgcctccaactctctacagaggcgcaagaaagggctcctgctacga
ccagtggcacctctgcgcaccaggccacccttgttaatcagcttgccccaagatttccgc
caggtgtcttcagttatagatgtggacctactgcctgagacccaccgacgagtgaggctg
cacaaacatgggtcagaccgtcccctgggtttctacattcgagatggcatgagtgttcgt
gtggctccccagggcctggagcgggtcccaggtatcttcatctcccgcctggtacgtggg
ggtctagctgagagtacagggctgctggcagtcagtgacgagatccttgaggtcaacggc
attgaggtggcggggaagaccttggaccaagtgacggacatgatggtcgccaacagccac
aacctcatcgtcactgtcaagcctgccaaccagcgcaataatgtggtacggggggcatct
gggcgtctgtcagggccttcctctgtagggcctgggcctactgatcctgacagtgacgat
gacagcagtgacctggtcattgagaatcgccaccctccctgttctaatgggctgtctcag
gggcccctgtgctgggacctgcaacctggctgcctacttcctggtgctggcagctctctg
ccctccttggagagcagagagcaagccaatcctggctggggtaacggcatgcgaggtgat
gttagcggattcagcctctga

DBGET integrated database retrieval system