KEGG   Mus pahari (shrew mouse): 110318868
Entry
110318868         CDS       T05929                                 

Gene name
Kif7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110318868 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318868 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110318868 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110318868 (Kif7)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110318868 (Kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110318868
NCBI-ProteinID: XP_021049851
Ensembl: MGP_PahariEiJ_G0013105
LinkDB
Position
1
AA seq 1342 aa
MGLEAQRLSGAEEAPVRVALRVRPLLPKELLHGHQSCLRVEPERGRITLGRDRHFGFHVV
LGEDTGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRAPSRLPRPAA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRSE
AERVPEEQAAGARGPPRHRSETRIIHRGRRVPCPAVGSAAVAAGLGAECARCRARTSAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESAPAEDQAAQGTSGR
KGDEGAQQLVTLQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
AQPGWGAPGLLQGLPPGSFVPRPHTAPLGGAHTHMLGMMPLTCLPGEEVGSEQQVVNGKE
VKAEVSAQVDKLGSVSSTTSEEEGEEGEEEEEEEEEEPPRRTLYLRRNGISNWSQRAGVR
PGSPPGRKGPEVCPEEPAGAIPVPQAVSSGKVPVQTRQAPAAMASEWRLAQAQQKIRELA
INIRMKEELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELCEGQRQLRELEGREP
QDASERSRLQEFRKRVAAAQSQVQVLKEKKQATERLVSLSAQSETRLQELERNVQLMRRQ
QGQLQRRLREETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSG
SNGSVVSLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKT
GLESKRLRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQNQQQIRGEIDTLRQEK
DSLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASA
SLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRL
VYWLEVALERQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIQALE
KELCRHMWINQELKQKLSAGSTAGQSRGCERRSLCLGNEDGLHPAAPEPLWQSSLLEGVS
RVLDESRDLVHAPLPLTWKRSSLCSEQGSEESRVRETTEPPVGRVLPMGEVGLSWNFGPL
PKPRWEPRRTSPGMIDVRKNPL
NT seq 4029 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaggctgtctggggctgaggaggccccggtgagggtggccctt
cgagttcgcccattgctgcccaaggagctgctgcatggtcatcagagttgcctgcgggtg
gagcctgagcgcggtcgaatcaccctggggcgtgaccgccactttgggttccatgtggtc
ctgggagaggacactgggcaagaggctgtgtaccaggcttgcgtgcagcccctcctcgag
gctttctttgagggcttcaatgccaccgtctttgcctatggtcagacaggctctgggaag
acgtacaccatgggggaggccagtgtggcctccctgcacgaagatgaacaaggtatcatc
ccaagggccatggctgaggccttcaagctcattgatgagaatgacctgctggactgcctg
gtacacgtgtcctacttggaactctacaaggaagaattccgagatctgctagaagtgggc
actgccagccgggacatccagcttcgggaagatgatcggggaaatgttgtgctctgtggg
gtgaaagaagtggacgtggaaggcctggacgaggtgctgagcctcctggagatgggcaac
gctgcgcgccacacaggcgccacacacttcaaccgcctctccagccgctcacacacagtc
ttcacggtgaccctggagcagaggggacgggctcccagccgcttgcctcgacccgccgct
ggccacctgctggtatccaaattccacttcgtggacctggcaggttccgagagggttctg
aagaccggcagcaccggagaacggctcaaagagagcatccagattaacagcaccctgctg
gcgctgggaaatgtcattagcgccctgggggacccccagcgccgaggcagccacatccca
taccgtgactccaagatcacccggatcctcaaagactctctgggcgggaatgccaagaca
gtgatgatcgcctgcgtcagtccctcctcctccgacttcgatgaaaccctcaacacccta
aactacgccagccgtgcccagaacatccgcaatcgcgccaccgtcaactggcgttcagag
gccgagcgcgttcccgaagaacaggcggcaggtgcgcgcgggccgccgcgacaccgctcg
gaaacgcgcatcatccaccgcggccggcgcgtgccctgcccagctgtgggctccgcggca
gtcgctgcgggcctgggggctgagtgcgcgcgctgccgggcccgcaccagcgccgcctac
agcctcctgcgagagctgcaggccgagcccgggctgcctggcgctgctgcccgcaaagtg
cgggactggctgtgcgcggtggagggcgagcgcagcgccttgagctctgcctccggaccc
gacagcggcatcgaaagcgctccagccgaggaccaggcggcacaggggaccagcgggaga
aagggagatgaaggggcccagcagctggtgaccctgcaaagccaggtggcccggctagag
gaggagaatcgagacttcctggcggctttggaggacgccatggagcagtacaaactgcag
agtgaccgcctgcgggagcagcaggaagagatggtggaactgcggctgcgcctagagctg
gcacagcctggctggggagcgccggggctcctgcagggcttgccaccgggatcctttgtg
ccccggcctcacacagcccccttggggggtgcccacactcacatgctgggcatgatgccc
ctgacatgtcttcctggagaagaagttggctctgagcagcaggtggtgaatggcaaggaa
gtcaaagcagaggtgtcggcccaggtggacaaactggggagtgtctcttccactacatca
gaggaggaaggggaggagggtgaggaggaagaggaggaagaagaagaggagccacccagg
cggaccttatacttgcgcagaaatgggatcagcaactggagtcagagggcaggggtgcgt
ccagggagcccacctggcaggaagggcccagaggtctgcccagaagaaccagctggtgcc
ataccagtaccacaagcagtcagtagtggcaaggtcccagttcagacccgccaggcccca
gctgccatggcctctgagtggcgactggcccaggcccaacagaagatccgggaactggcc
atcaacatccgcatgaaggaggagctcattggcgaactggtccggacagggaaggcggcc
caggccctgaaccgccagcacagccagcgcatccgggagctggagcaggaggctgagcgt
gtgcgggcagagctgtgtgaagggcagaggcagcttcgagagctggagggcagggagccc
caggatgccagtgagaggtccaggctccaggaattccgtaagagagtggctgcagcccaa
agccaggtgcaggtgctgaaggagaagaagcaggcaacagagcggctggtgtcactgtcg
gctcaaagtgagacccggctgcaggagctggagaggaatgtgcagctcatgcggcgacag
caggggcagctgcagaggcggctccgtgaggagacagagcagaagcggcgcctagagacg
gagatgaacaagcggcagcatcgcgtcaaggagctggagctgaagcacgagcaacagcaa
aagatcctgaaaatcaagacagaagagatcgcagccttccagaggaagaggcgcagcggc
agcaacggctctgtggtgagcctggagcagcagcagaagatcgaggagcagaagaagtgg
ctggaccaggagatggaaaaggtgttgcagcagcggcgggcactggaggaattgggagag
gaactccgcaagcgggaggtcatcctggccaagaaggaggccctgatgcaggagaagacg
gggctagagagcaagcgcctgaggtccagccaggccctaaatgaagacattgtgcgcgtg
tccagccgcctggaacacctggagaaggagctatctgagaagagtgggcagctgcggcaa
ggcagtgcccagaaccagcagcagatcagaggggagatagacaccctgcgccaggagaag
gactcactgttgaagcaacgcctggagattgatagcaagctgaggcagggaagcctgctg
tcacctgaggaggagaggacactgttccagctggatgaagccatcgaggccctggacgct
gccatcgagtacaagaatgaggctatcacatgtcgccagcgggtgctgcgggcttcggcc
tccttgctgtcccagtgtgagatgaatctcatggcaaagctcagctacctttcctcctca
gagactagagccctgctgtgcaagtattttgacaaggtggtgacactccgagaggagcaa
caccagcaacagattgccttctcggagctggagatgcagctggaggagcagcagcggctg
gtgtattggctggaggtggccctggagcggcagcgcctggagatggaccgtcagctgacc
ctgcagcagaaggagcatgagcagaatgtgcagctgctccttcagcaggggcgagaccac
cttggcgaggggttagcagacagcaagaggcaatatgaggcccggattcaagctctggag
aaggaactatgtcgacacatgtggataaaccaggagctgaagcaaaagctcagtgcagga
agcaccgcaggccagagccgggggtgtgagaggagaagcctctgccttggaaatgaagat
ggtctccatcccgcagctcctgaacctctctggcagtcctcccttctggagggggtgtcc
cgtgtgttggatgagtcccgggacttggtccatgccccactacccctgacatggaaacgc
tcaagcttgtgcagcgagcagggctctgaggagtctagggtccgggagacaactgaaccc
ccagtagggcgggtgctacctatgggtgaagtgggcctttcctggaactttggacccttg
cctaagccccggtgggaaccccgaagaaccagcccagggatgatcgatgtcaggaaaaac
cccttgtag

DBGET integrated database retrieval system