KEGG   Mus pahari (shrew mouse): 110318900
Entry
110318900         CDS       T05929                                 
Symbol
Tfpi
Name
(RefSeq) tissue factor pathway inhibitor isoform X1
  KO
K03909  tissue factor pathway inhibitor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110318900 (Tfpi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110318900 (Tfpi)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110318900 (Tfpi)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   110318900 (Tfpi)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110318900 (Tfpi)
SSDB
Motif
Pfam: Kunitz_BPTI
Other DBs
NCBI-GeneID: 110318900
NCBI-ProteinID: XP_021049890
Ensembl: MGP_PahariEiJ_G0025169
LinkDB
Position
3:complement(69764395..69809061)
AA seq 305 aa
MTYKMKKEHAFWATVCLLLSLVPELLNALSEEADDTDSELRPMKPLHTFCAMKAEDGPCK
AMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYKKTTITTASGAERPDF
CFLEEDPGLCRGFMKRYFYNNQTKQCERFVYGGCLGNSNNFETLDECKNTCEDPVHPSSP
VNEVQMSDYVTDRNIVTDRTTVNNIVIPQSPKVPRRRDYRGRPWCLEPADSGLCKASERR
FYYNSATGKCHRFNYTGCGGNNNNFTTRKGCLRACKTGLIKTKSKGVKIQRKKAPFVKVE
YESIN
NT seq 918 nt   +upstreamnt  +downstreamnt
atgacttacaaaatgaagaaagaacatgccttttgggccactgtgtgtctgttgcttagc
cttgtccccgagcttcttaatgctctgtctgaggaagctgatgacacagattctgagctg
cggccaatgaaaccgctgcatacattttgtgcaatgaaggcagaagatggtccatgcaaa
gcaatgataaggagttattttttcaatatgtatactcatcaatgtgaagaatttatatac
gggggatgtgaagggaacgagaaccgatttgataccttggaagagtgtaagaaaacatgc
ataccaggttataagaagacaactataacgacagcatctggagcagaaaggccagatttc
tgcttcttggaagaggaccctggactctgccgaggtttcatgaagaggtatttttataac
aaccagacaaagcagtgtgaacgattcgtgtacggcggttgcctgggtaacagcaacaac
tttgaaactttggatgagtgcaagaacacctgtgaggatccagtccacccctcttcccca
gtgaatgaggtacagatgagtgactacgtaactgatcgcaatattgtaactgatcgcact
actgtaaataacattgtgattccccagtctcccaaagtgcccaggcgtcgggactatcgt
ggccgtccctggtgtcttgaaccagcagacagtggattatgtaaagccagtgagagaaga
ttctactacaattcagctactgggaaatgccaccgatttaactacactggatgtggggga
aataataataattttactaccagaaaaggctgtctgagagcatgtaaaacaggtctcatc
aaaacaaagtcaaaaggagtaaagatccaaagaaaaaaggcgcctttcgtgaaagtcgaa
tatgaaagcattaattag

DBGET integrated database retrieval system