KEGG   Mus pahari (shrew mouse): 110318923
Entry
110318923         CDS       T05929                                 

Gene name
Ppp2r2d
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110318923 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110318923 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    110318923 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    110318923 (Ppp2r2d)
   04152 AMPK signaling pathway
    110318923 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110318923 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110318923 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    110318923 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110318923 (Ppp2r2d)
   05165 Human papillomavirus infection
    110318923 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110318923 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110318923 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110318923 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110318923 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110318923 (Ppp2r2d)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110318923 (Ppp2r2d)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110318923 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 110318923
NCBI-ProteinID: XP_021049932
Ensembl: MGP_PahariEiJ_G0013815
LinkDB
Position
1
AA seq 453 aa
MAGAGGGGCPAGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDITLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggcggcggctgcccggcgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagctgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaaccggagacaaaggtggcagagttgttatt
ttccaacgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgggataaaagagcagaaggttat
aacttgaaagatgaagatggacgccttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagccagctaatatggaggagctgacagaagtcatcactgccgcagagttc
cacccacatcagtgcaatgtatttgtctacagcagcagcaaggggaccatcagactttgt
gacatgcgttcctctgccctatgtgacaggcatgccaagttttttgaagagccagaagat
cccagcagtagatcctttttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgaccagagactatctgtcggtgaaggtatgggacctcaac
atggagggcaggcctgttgagacccaccaggtacatgagtacctacgaagcaagctctgc
tccttgtatgagaatgactgcatctttgacaagttcgagtgctgctggaatggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatattacactggaagcctcaagagaaaacagcaaaccccgagccagcctgaagccc
cggaaagtatgcacaggggggaagagaaagaaagatgagattagcgtggacagtttggac
ttcaataagaagatccttcacacagcctggcaccccatggagagcattattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

KEGG   Mus pahari (shrew mouse): 110325313
Entry
110325313         CDS       T05929                                 

Gene name
Ppp2r2a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110325313 (Ppp2r2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110325313 (Ppp2r2a)
   04071 Sphingolipid signaling pathway
    110325313 (Ppp2r2a)
   04151 PI3K-Akt signaling pathway
    110325313 (Ppp2r2a)
   04152 AMPK signaling pathway
    110325313 (Ppp2r2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110325313 (Ppp2r2a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110325313 (Ppp2r2a)
  09156 Nervous system
   04728 Dopaminergic synapse
    110325313 (Ppp2r2a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110325313 (Ppp2r2a)
   05165 Human papillomavirus infection
    110325313 (Ppp2r2a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110325313 (Ppp2r2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110325313 (Ppp2r2a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110325313 (Ppp2r2a)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110325313 (Ppp2r2a)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110325313 (Ppp2r2a)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110325313 (Ppp2r2a)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110325313 (Ppp2r2a)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 110325313
NCBI-ProteinID: XP_021058896
Ensembl: MGP_PahariEiJ_G0030463
LinkDB
Position
8
AA seq 457 aa
MFPKFSLRSIFHGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGG
RVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQF
LLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRR
IFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVIT
AAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISD
VKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCW
NGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCAGGKRKKDEISV
DSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgttcccgaagttttctcttcggtctatatttcatggagctggaggagggaatgatatt
cagtggtgtttttctcaggtgaaaggagcagtagatgatgacgtagcagaagcagatata
atttctacagtagagtttaatcattctggagaattactagccactggagataaaggtggg
agagttgtcatctttcaacaagagcaggagaacaaaatccagtctcatagcagaggagaa
tacaatgtttacagcaccttccagagccatgagccagaatttgactacttgaaaagctta
gaaatagaagagaagatcaacaaaattaggtggttaccccagaaaaatgctgcccagttt
ttattgtctaccaacgataaaacaataaaattatggaaaatcagtgaaagagacaaaaga
ccagaaggctataacttgaaagaggaagatggaagatatagagatcctactacagtcact
acactacgggtgcccgtatttaggcccatggatctaatggtggaagctagtccacggaga
atatttgccaacgcccatacttatcacatcaactcaatttctatcaatagtgattatgaa
acctacttatcagcagatgatttgcgaattaatctctggcatctggaaattacagacagg
agttttaatattgtggacatcaagcctgccaacatggaagagctcacagaggtgatcaca
gctgcagagtttcacccgaatagctgtaacacttttgtgtacagcagcagtaaagggact
attcggttatgtgacatgagggcatctgcgctctgtgacaggcattctaaactgtttgaa
gaacctgaagatcccagcaacaggtcatttttttctgaaatcatctcctctatttctgat
gtaaaattcagccatagtggtcgttatatgatgactagagactatttgtcagtcaaaatt
tgggacttgaatatggaaaacaggccggtggagacataccaggtacatgaatacctcaga
agtaaactttgctcactgtatgaaaacgactgcatatttgacaaatttgaatgttgttgg
aatgggtctgacagcgttgtcatgactggatcctacaataatttcttcagaatgttcgac
aggaacacaaagcgggatataaccctagaagcatcacgagagaacaataagcctcgcacg
gttttgaagccacgcaaagtctgtgcaggcggcaagcggaagaaagacgaaataagtgtt
gacagcctagacttcaacaagaagatccttcatacggcctggcatcccaaggaaaacatc
attgctgtagcgactacaaacaatctgtatatatttcaagacaaagtgaattag

KEGG   Mus pahari (shrew mouse): 110328279
Entry
110328279         CDS       T05929                                 

Gene name
Ppp2r1b
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110328279 (Ppp2r1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110328279 (Ppp2r1b)
   04390 Hippo signaling pathway
    110328279 (Ppp2r1b)
   04071 Sphingolipid signaling pathway
    110328279 (Ppp2r1b)
   04151 PI3K-Akt signaling pathway
    110328279 (Ppp2r1b)
   04152 AMPK signaling pathway
    110328279 (Ppp2r1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110328279 (Ppp2r1b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110328279 (Ppp2r1b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110328279 (Ppp2r1b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110328279 (Ppp2r1b)
   04730 Long-term depression
    110328279 (Ppp2r1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110328279 (Ppp2r1b)
   05165 Human papillomavirus infection
    110328279 (Ppp2r1b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110328279 (Ppp2r1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110328279 (Ppp2r1b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110328279 (Ppp2r1b)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110328279 (Ppp2r1b)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110328279 (Ppp2r1b)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110328279 (Ppp2r1b)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110328279 (Ppp2r1b)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 CLASP_N M11L DUF3730 AEP1
Other DBs
NCBI-GeneID: 110328279
NCBI-ProteinID: XP_021063380
Ensembl: MGP_PahariEiJ_G0015067
LinkDB
Position
10
AA seq 694 aa
MAGAAGPGAGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKTEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSQDDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKIALSDLIPAFQ
SLLRDCEAEVRAAAAHKVRELCENLPAEGREAVIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTVLGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGKEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQ
RLRKLDFPVKDSEEPGIPRVDKNLFLRPRGPGEDTGKAQRDRAAPVASEEAVEAAQLRGT
NTAKGPACQLHINTRDTLAQLEIADAMHFPQSRE
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggcgggcgcagcggggccaggggccggtccgggggcagcgggcggagatggagacgat
tcgctctacccgattgcggttttaatcgacgagctccgcaacgaggacgtgcagctccgt
ctcaacagtattaagaagttatcaactattgctctagcactcggggtagaaaggactcga
acggaactgctgccttttcttacagatactatttatgatgaagacgaggtgctgttagct
cttgctgagcagctgggaaatttcactggcttggtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaagtttggctacggtggaggagactgtcgttcgagacaaggct
gtggagtcgctgaggcagatctcacaggagcacactcccgttgcccttgaagctcatttt
gtgcctctggtgaagcgcctggctagcggggactggttcacctcgcgcacgtctgcatgt
ggcttgttcagtgtttgctaccccagagcttcaaatgctgtcaaggcagagattcgacag
cacttccgttctctctgctcggatgatacaccaatggtgagacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaactgaaattgttccattg
ttcacgaatctggcttcagatgaacaggactctgtgcgcctgctagccgtggaagcctgt
gttagtattgcccagttactgtctcaggatgacctggaagccttggtaatgcctacactt
cggcaagcagcagaagataaatcctggcgggttcgatatatggtggctgacaaattttca
gagctccagaaagcagtgggccctaaaattgcacttagtgacctcatccccgccttccag
agcctcctcagagactgcgaagctgaagtccgagcagccgctgcccacaaagtaagagaa
ctttgcgagaacctgcctgctgaaggtagagaggctgtaattatgaatcaaatcctgccc
tatataaaggaattagtgtctgataccaaccaacatgtcaagtcagcgctagcttctgta
attatgggattatctacagttttgggcaaagagaataccattgaacatcttctgcctctg
tttttagctcagttaaaggatgagtgtccagaagtccgtttaaatatcatctccaatttg
gattgtgtgaatgaagtgattggaatccgtcagctctctcagtccctccttccggccata
gtggaactggctgaagatgccaagtggagggtccgcctggccatcattgagtacatgccg
ctgctggctggccagctgggtgtggagttctttgatgaaaaactcaattctttgtgtatg
gcctggcttgtggatcatgtctatgccattcgggaagcagccaccaacaacctcatgaag
ttagtccagaagttcggtacagagtgggcccagaataccattgtccctaaagtgttggta
atggcaaatgatcctaactacttgcacagaatgaccactttattctgcattaatgcactg
tctgaagcctgtggtaaggaaataaccactaagcaaatgttgcccattgtgttgaaaatg
gcaggagaccaagtagcaaatgtccgcttcaatgtggccaaatcactgcagaaaattgga
ccaattctagacaccaatgccttgcagggggaagtgaagccggtgctgcagaaattaggt
caggatgaagacatggatgtcaaatattttgcccaggaagctataagtgtggtggcacag
aggctgaggaagctagattttcctgtgaaggacagtgaagagcccggcatccctagggtt
gacaagaatctcttcctgagaccccgagggcctggagaggacactgggaaggcacagaga
gaccgagcagctccggtggcttccgaggaggcagtagaggcagcccagcttaggggcaca
aacacagcaaagggaccagcatgtcagttgcatataaatactagagacacacttgcccaa
ctggaaattgcagacgcaatgcatttcccccaaagcagagagtaa

KEGG   Mus pahari (shrew mouse): 110330369
Entry
110330369         CDS       T05929                                 

Gene name
Ppp2r2c
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110330369 (Ppp2r2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110330369 (Ppp2r2c)
   04071 Sphingolipid signaling pathway
    110330369 (Ppp2r2c)
   04151 PI3K-Akt signaling pathway
    110330369 (Ppp2r2c)
   04152 AMPK signaling pathway
    110330369 (Ppp2r2c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110330369 (Ppp2r2c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110330369 (Ppp2r2c)
  09156 Nervous system
   04728 Dopaminergic synapse
    110330369 (Ppp2r2c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110330369 (Ppp2r2c)
   05165 Human papillomavirus infection
    110330369 (Ppp2r2c)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110330369 (Ppp2r2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110330369 (Ppp2r2c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110330369 (Ppp2r2c)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110330369 (Ppp2r2c)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110330369 (Ppp2r2c)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110330369 (Ppp2r2c)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110330369 (Ppp2r2c)
SSDB
Motif
Pfam: BSMAP
Other DBs
NCBI-GeneID: 110330369
NCBI-ProteinID: XP_021066022
Ensembl: MGP_PahariEiJ_G0016949
LinkDB
Position
13
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgacagaagctgacgtcatctccactgtcgagttcaaccacaccggggaactgctcgcc
acaggtgacaagggtggcagggtggttatcttccagcgggaaccagagagtaagaacgca
cctcacagccagggtgagtatgatgtgtacagcaccttccagagccatgagccggagttt
gactacctgaagagcctggagatagaggaaaaaatcaacaagatcaaatggctcccgcag
cagaacgccgcgcactcgctgctgtccaccaatgataaaactattaaattatggaagatt
accgaacgagacaagaggcccgagggctacaacctgaaggatgaggaggggaagctgaaa
gacctgtctacggtgacgtcactgcaggtgcctgtgctgaagcccatggacctgatggtg
gaggtgagcccgagaaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagcgactgcgagacgtacatgtcagcggacgacctccgcatcaacctctggcat
ctggccatcactgatcggagcttcaacatcgtagacatcaagccagccaacatggaggac
ctcacagaggtgatcacagcatccgagttccatccgcaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgtgacatgcgggcagctgccctgtgcgacaag
cactccaagctctttgaagagcccgaggaccccagcaaccgctccttcttttcagagatc
atctcctcagtgtccgacgtgaagttcagccacagtgggcgctacatgctcacgagggat
tacctcacggtcaaggtctgggacctgaacatggaggcgaggcccatagagacctaccag
gtccacgactacctgcggagtaagctctgctccctgtatgagagtgactgcatcttcgac
aagtttgagtgtgcctggaacgggagtgacagtgtcatcatgacaggggcctacaacaac
ttcttccgcatgttcgaccgtaacaccaagcgggacgtgacgctggaggcctcgagggag
agcagcaaacccagagcggtgctcaagccaaggcgcgtgtgtgtgggtggcaagcggcgg
cgtgacgacatcagcgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccagccgagaatatcattgccatcgcagccaccaacaacctgtacatcttccaggat
aaggtcaattctgacatgcactag

KEGG   Mus pahari (shrew mouse): 110331422
Entry
110331422         CDS       T05929                                 

Gene name
Ppp2ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04136  Autophagy - other
mpah04140  Autophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110331422 (Ppp2ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110331422 (Ppp2ca)
   04390 Hippo signaling pathway
    110331422 (Ppp2ca)
   04071 Sphingolipid signaling pathway
    110331422 (Ppp2ca)
   04151 PI3K-Akt signaling pathway
    110331422 (Ppp2ca)
   04152 AMPK signaling pathway
    110331422 (Ppp2ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110331422 (Ppp2ca)
   04136 Autophagy - other
    110331422 (Ppp2ca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110331422 (Ppp2ca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110331422 (Ppp2ca)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110331422 (Ppp2ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    110331422 (Ppp2ca)
   04730 Long-term depression
    110331422 (Ppp2ca)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110331422 (Ppp2ca)
   05165 Human papillomavirus infection
    110331422 (Ppp2ca)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110331422 (Ppp2ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110331422 (Ppp2ca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110331422 (Ppp2ca)
   04131 Membrane trafficking [BR:mpah04131]
    110331422 (Ppp2ca)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110331422 (Ppp2ca)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110331422 (Ppp2ca)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110331422 (Ppp2ca)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     110331422 (Ppp2ca)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110331422 (Ppp2ca)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110331422 (Ppp2ca)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110331422 (Ppp2ca)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110331422 (Ppp2ca)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 110331422
NCBI-ProteinID: XP_021067651
Ensembl: MGP_PahariEiJ_G0017458
LinkDB
Position
14
AA seq 309 aa
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaagttgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgttcaagaggttcgatgtccagtcactgtgtgtggagatgtgcatggg
caatttcatgatctcatggaactctttagaattggtggtaaatcaccagatacaaattac
ctgtttatgggagactatgtggacagaggatattactccgttgaaacagttacactgctt
gtagctcttaaggttcgttaccgagagcgtatcaccatactccgagggaatcacgagagc
agacagatcacacaggtttatgggttctacgatgagtgtttaaggaaatacggaaatgca
aacgtttggaaatacttcacagacctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctgtcgccatccatagacacactggatcacatc
cgagcacttgatcgcctacaagaagttcctcatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggaggctgggggatatctcctcgaggagctggttataccttt
ggccaagatatttctgagacatttaatcatgccaatggcctcacattggtgtccagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacaattttc
agtgctccaaactattgctatcgctgtggtaaccaagctgcaatcatggaacttgacgac
acccttaagtattctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtc
actcgtcgtaccccagactacttcctgtag

KEGG   Mus pahari (shrew mouse): 110332843
Entry
110332843         CDS       T05929                                 

Gene name
Ppp2r2b
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110332843 (Ppp2r2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110332843 (Ppp2r2b)
   04071 Sphingolipid signaling pathway
    110332843 (Ppp2r2b)
   04151 PI3K-Akt signaling pathway
    110332843 (Ppp2r2b)
   04152 AMPK signaling pathway
    110332843 (Ppp2r2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110332843 (Ppp2r2b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110332843 (Ppp2r2b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110332843 (Ppp2r2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110332843 (Ppp2r2b)
   05165 Human papillomavirus infection
    110332843 (Ppp2r2b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110332843 (Ppp2r2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110332843 (Ppp2r2b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110332843 (Ppp2r2b)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110332843 (Ppp2r2b)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110332843 (Ppp2r2b)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110332843 (Ppp2r2b)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110332843 (Ppp2r2b)
SSDB
Other DBs
NCBI-GeneID: 110332843
NCBI-ProteinID: XP_021069814
Ensembl: MGP_PahariEiJ_G0018963
LinkDB
Position
15
AA seq 548 aa
MHQPPPASCSRSSSTSSSCECAPVGVRVRALALAAAPSLAPSQLPSPRLREPPSRGTSTL
ISARLGPWCSPTGSPAPLSCETGCGVGSWILVCRLLVPTQVSLLSMEEDIDTRKINNSFL
RDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQS
HEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDE
EGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLR
INLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRAS
ALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRP
IETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTL
EASRENSKPRAILKPRKVCIGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNL
YIFQDKVN
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcaccagccgcctccagcctcctgcagcaggagcagcagcaccagcagcagctgcgag
tgcgcccctgtgggtgtgagggtgagagcgctggcgctggctgcagcgcccagcctagct
cctagccagcttcctagcccccgcctgcgggagccgccctctcgtgggaccagcaccctc
atctcagcaaggctcggaccatggtgcagtcccactggctcccctgcccccctctcctgt
gagactggctgcggggtgggatcatggatacttgtctgccggcttctggttcccacgcaa
gtaagcctgctgtcaatggaggaggacattgatacccgcaaaatcaacaacagtttcctg
cgcgaccacagctatgcaaccgaagctgacattatctctacggtagaattcaaccacacg
ggagagttactagcgacgggggacaaggggggtcgggttgtaatatttcagcgagaacag
gagagtaaaaaccaggttcatcgtaggggtgaatacaatgtttacagcacattccagagc
catgaaccagagttcgattacctgaaaagtttagaaatagaagaaaaaatcaataagata
agatggctccctcaacaaaacgcagcttactttcttctgtctaccaacgataaaactgtg
aagctgtggaaagtcagtgagcgggataagaggccagaaggctacaacctgaaagatgag
gagggccgactccgggatcctgccaccatcacaaccctgcgggtgcctgtcctgagaccc
atggacctaatggtggaggccaccccacgaagagtgtttgccaatgcgcacacataccac
atcaactctatatctgtcaacagcgactatgagacctacatgtctgctgatgacctgagg
attaacctgtggaactttgagattaccaaccagagttttaatatcgtggacatcaagcca
gccaacatggaagaactcacagaggtaatcacagcagctgagttccacccccaccactgc
aacacctttgtatacagcagcagcaaggggacaatccggctgtgcgacatgcgtgcctcc
gcgctgtgtgacaggcacaccaagttttttgaagagccagaagatccaagcaacagatcg
tttttctctgaaattatctcttcaatttcggatgtgaagttcagccacagtgggaggtat
atcatgaccagagactatctgaccgtgaaagtctgggatctcaacatggaaaatcgcccc
attgagacataccaggttcatgactacctccgcagcaagttgtgctccctctatgaaaat
gactgcatttttgataaatttgagtgtgtatggaatgggtcagacagcgtcatcatgacg
ggctcctacaataacttcttcaggatgttcgaccgaaacaccaagcgtgatgtgaccctt
gaggcctcaagggaaaacagcaaaccccgggctatcctcaaaccccgaaaagtgtgcatc
gggggcaagcgaagaaaagatgagatcagtgttgacagtctggactttagcaaaaagata
ttgcatacagcttggcatccttcagaaaacattatagcagtggcggctacgaataactta
tatatattccaggacaaggttaactag

KEGG   Mus pahari (shrew mouse): 110336304
Entry
110336304         CDS       T05929                                 

Gene name
Ppp2cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform isoform X1
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04136  Autophagy - other
mpah04140  Autophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110336304 (Ppp2cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110336304 (Ppp2cb)
   04390 Hippo signaling pathway
    110336304 (Ppp2cb)
   04071 Sphingolipid signaling pathway
    110336304 (Ppp2cb)
   04151 PI3K-Akt signaling pathway
    110336304 (Ppp2cb)
   04152 AMPK signaling pathway
    110336304 (Ppp2cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110336304 (Ppp2cb)
   04136 Autophagy - other
    110336304 (Ppp2cb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110336304 (Ppp2cb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110336304 (Ppp2cb)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110336304 (Ppp2cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    110336304 (Ppp2cb)
   04730 Long-term depression
    110336304 (Ppp2cb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110336304 (Ppp2cb)
   05165 Human papillomavirus infection
    110336304 (Ppp2cb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110336304 (Ppp2cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110336304 (Ppp2cb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110336304 (Ppp2cb)
   04131 Membrane trafficking [BR:mpah04131]
    110336304 (Ppp2cb)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110336304 (Ppp2cb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336304 (Ppp2cb)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110336304 (Ppp2cb)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     110336304 (Ppp2cb)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110336304 (Ppp2cb)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110336304 (Ppp2cb)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110336304 (Ppp2cb)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110336304 (Ppp2cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 110336304
NCBI-ProteinID: XP_021074401
Ensembl: MGP_PahariEiJ_G0021434
LinkDB
Position
19
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtggagcagctcaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaacg
aaagaatcaaatgtgcaagaggtccgctgtcctgttaccgtctgtggagatgtgcatggc
caattccatgaccttatggaactcttcagaattggtgggaaatcaccagatacaaactac
ctattcatgggggactatgtggacagaggatattattctgtggagactgtgactcttctt
gtagcattaaaggtgcgctatccagagcgcatcacaatattgcgaggaaatcacgaaagc
cggcagatcacacaagtgtatggcttttatgatgagtgcctacggaagtacggaaatgcc
aacgtgtggaaatactttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccacggtggcctctccccatccatagatacattggaccacata
agagccctggatcgcttgcaagaagttccacatgagggcccaatgtgtgatctcttatgg
tcagatccggatgaccgtggtggctggggcatttctccacgtggtgctggctacacattt
ggacaagacatttctgaaacatttaaccatgccaacggcctcacactggtgtctcgtgct
caccagcttgtaatggaaggatataactggtgccatgatcggaatgtggtcaccattttt
agtgcgcccaattactgctaccgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatactcgtttcttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcaccccagactacttcctgtaa

KEGG   Mus pahari (shrew mouse): 110337932
Entry
110337932         CDS       T05929                                 

Gene name
Ppp2r1a
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03015  mRNA surveillance pathway
mpah04071  Sphingolipid signaling pathway
mpah04114  Oocyte meiosis
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah05142  Chagas disease
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110337932 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110337932 (Ppp2r1a)
   04390 Hippo signaling pathway
    110337932 (Ppp2r1a)
   04071 Sphingolipid signaling pathway
    110337932 (Ppp2r1a)
   04151 PI3K-Akt signaling pathway
    110337932 (Ppp2r1a)
   04152 AMPK signaling pathway
    110337932 (Ppp2r1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110337932 (Ppp2r1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110337932 (Ppp2r1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110337932 (Ppp2r1a)
  09156 Nervous system
   04728 Dopaminergic synapse
    110337932 (Ppp2r1a)
   04730 Long-term depression
    110337932 (Ppp2r1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110337932 (Ppp2r1a)
   05165 Human papillomavirus infection
    110337932 (Ppp2r1a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110337932 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110337932 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110337932 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110337932 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     110337932 (Ppp2r1a)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     110337932 (Ppp2r1a)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     110337932 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 110337932
NCBI-ProteinID: XP_021076715
Ensembl: MGP_PahariEiJ_G0023441
LinkDB
Position
21
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcagctgccgacggtgacgattcgctctatcccattgcggtgctcatagatgaactc
cgcaatgaggacgttcagcttcgtctcaatagtatcaagaagctctccacgattgccttg
gcccttggggttgaacggaccagaagtgaactcctgcccttccttacagataccatttat
gatgaagatgaggtcctcttggccttggctgaacagctgggaaccttcaccactttggtg
ggagggcctgagtatgtgcactgtctgctgccacccctggagtcactggccacagtggaa
gagacagtagtgcgagacaaggcggtagaatccttgcgggccatctctcatgagcactca
ccttcagatctagaggctcactttgtgcctctggtgaagcggctggcgggtggagactgg
ttcacctcccgcacctcggcctgtggtctcttctcagtttgctacccccgagtatccagt
gccgtgaaggcagaacttcgacagtacttccggaacctgtgctcagatgacacccctatg
gtgcggcgggccgctgcctccaagctgggggaatttgccaaggtactggagctggacaat
gtcaagagtgagatcattcccatgttctctaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcatgtgtgaatattgctcagctcctgccgcaggaggatctg
gaggccttagtgatgcccaccttgcgacaggctgctgaggacaagtcttggcgtgttcga
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagattaccaag
acagatctggtgcctgccttccagaacctgatgaaggactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaatctctcagctgactgccgggagaat
gtgatcatgacccagatcttgccctgcatcaaggagcttgtgtcagatgccaaccaacat
gtcaagtcagcactggcttcagtcatcatgggcctctctcccattctgggcaaagacaac
accatcgaacacctcttgcccctgttcttggctcagctgaaggatgagtgtcctgaagtg
cggctgaatatcatctccaacctggattgtgtgaatgaggtgattggcatcaggcagctc
tctcagtccttgcttcctgccatcgtggaactagctgaagatgccaagtggcgagtgcgg
ctggccatcattgaatacatgcctctgctggctggacagcttggtgtggaattttttgat
gagaaacttaactctttgtgtatggcctggctagtggatcatgtctatgctatccgtgag
gctgccaccagcaaccttaagaagctagtggagaagttcgggaaggagtgggcccatgcc
actatcatccccaaggtcttagccatgtctggagaccctaactacctgcaccgaatgact
acactcttctgcatcaatgtgttgtctgaggtctgtggacaggatatcaccaccaagcac
atgctacccacagttcttcgtatggctggtgacccagtggccaatgtccgcttcaatgtg
gccaagtcattacagaagataggacccattcttgataacagcaccctgcagagtgaagtc
aagcccatcctggagaagctgacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctcttactgttctctctcttgcctga

DBGET integrated database retrieval system