KEGG   Mus pahari (shrew mouse): 110319523
Entry
110319523         CDS       T05929                                 
Symbol
Asip
Name
(RefSeq) agouti-signaling protein
  KO
K08725  agouti signaling protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110319523 (Asip)
SSDB
Motif
Pfam: Agouti Toxin_9
Other DBs
NCBI-GeneID: 110319523
NCBI-ProteinID: XP_021050669
Ensembl: MGP_PahariEiJ_G0025964
LinkDB
Position
3:137408991..137431168
AA seq 131 aa
MDATRLLLATLVGFLCFFTVYSHLALEEMLGDDRSLRSNSSMNSLDFSSVSIVALNKKSK
KISRKEAEKRKRSSKKKASMRKVARPSPPSPCVATRDSCKPPAPACCDPCASCQCRFFGS
ACVCRVLNPNC
NT seq 396 nt   +upstreamnt  +downstreamnt
atggatgccacccgcctactcctggccaccctagtgggcttcctgtgcttcttcaccgtc
tacagccacctggccctcgaggagatgcttggagatgacaggagtctgcggagtaactcc
tccatgaactcgctggatttctcctctgtttctatcgtggcactgaacaagaaatccaag
aagatcagcagaaaagaagccgagaagcggaaaaggtcttccaagaaaaaggcttcgatg
aggaaggtggcaaggccctcgccaccttcgccctgcgtggccacccgcgacagctgcaag
ccgcccgcgcccgcctgctgcgacccgtgtgcctcctgccagtgccgtttcttcggcagc
gcctgcgtgtgccgagtactcaaccccaactgctga

DBGET integrated database retrieval system