KEGG   Mus pahari (shrew mouse): 110319952
Entry
110319952         CDS       T05929                                 

Gene name
Fat4
Definition
(RefSeq) protocadherin Fat 4 isoform X1
  KO
K16669  protocadherin Fat 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110319952 (Fat4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110319952 (Fat4)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Cadherin related
   110319952 (Fat4)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Laminin_G_2 Laminin_G_1 Cadherin_3 EGF EGF_CA hEGF EGF_2 EGF_3 Big_9 SusE
Other DBs
NCBI-GeneID: 110319952
NCBI-ProteinID: XP_021051368
Ensembl: MGP_PahariEiJ_G0026395
LinkDB
Position
4
AA seq 4981 aa
MNLAANLAPGRRRILLPSPSLCQLLRVWGLLSLLPGSARVQAAEHRQVFQVMEEQPPGTL
VGTISTRPGFTYRLSESHALFAINSSTGALYTTATIDRESLPSDVVNLVVLSSSPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHRSYRIVSGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQTGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP
ETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVY
RVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGL
DRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPAFSQPEGYEVSVVENAPIGT
ELLVLGATDRDLGDNGTVRFSLQEAEGDQRLFRLDPVSGRLSTISSLDREEQAFYCLSIL
ATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGP
NGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVT
VTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNANISYLITTGDQRGMFA
MNPITGQLTTASVIDREEQSFYQLRVVASGGAITGDTVVNITVKDLNDNAPHFLQSVESI
NAVENWQAGHSIFQAKAMDPDEGVNGRVLYSLKQNPKNLFTINEQNGNISLLGALDVHSG
SYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQA
SDKDSGANGEIAYAITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPL
SATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFE
VAQPNFELHAITGEITNTHKFDRESLMRRRGTAVFSFTVIAMDQGLPQPLKDQATVHVYM
KDINDNAPKFLKDFYQATISETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAI
DSLSGQVTLVGKLDYETTSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTL
FVDVLENMRIGELVSSITATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDF
ETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVI
SVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKAND
QAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGAN
GEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVI
LQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRL
FTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVF
PTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATK
RLDREHRSKYSLLVRADDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLV
AAILATDDDSGVNGEISYVVEEDDGDGVFFLNPVTGVFNLTRALDYEMQQYYILTVHAED
GGGQFTTVRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLS
YSIASGDSLGQFAVDKHGILKALKALDRESQSFYNLVIQVHDLPQPPASRFTSTAQVSII
LLDVNDNPPMFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIG
TIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAVYR
VQVKEDILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRE
MIPAYTLTVQATDRGSSPRMDSCTVTITLLDMNDFVPVFELSPYSVNVPENLGTLPRTIL
QVVARDDDQGPNSQLSYVLLGGNEDNAFALTASGELRVTQSLDREARDHFVLVVTAADAG
SPALTGTGTINIIVDDINDNVPTFANNMYLTSIPEDARTGTDVLLVNASDADAAANAVIS
YSIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPVSLSSSTSVLVTITD
VNDNPPRFQHHPYVTHVPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPL
RGAIMAAGPLSGASEVTFSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPE
NQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYVVW
IEARDGGFPPFSSYEKLDITVLDINDNAPAFEEDPFVSEILENLSPRKILTVSATDKDSG
PNGQLDYEIVNGNQERSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVK
VIISILDENDNAPRFSQIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPF
TINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYY
LDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNV
SGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKV
GTKLIKVTAVDDKDFGLNSEVEYFMLDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIR
VTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDT
AMNGLISYNISSGNEEGIFAINSSTGVVTLAKALDYELSSKHEMTISATDGGWVARTGYC
SLTVSVIDVNDNSPVFVPDEFFPTVLENAPSGTTVIHLNATDADSGANAVIAYTVQSSDS
DLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRF
VSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVS
GLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDPPVFSLNTYRVQISEGVP
IGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNL
TVLAVDSGTPSATGSASLLVTLEDINDNGPVLTVSEGEVLENKRPGTLVMTLQSTDPDLP
PNQGPFNYYLLSTGPATNYFSLSTTGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTG
TVHITVLDQNDNPSQSRTVEIFVNYYGNLFPGGTLGSVKPQDPDVLDSFHCSLTSGVTSL
FSIPAGSCDLSSQPRSTDGTFDLTVVSSDGVHSTVTNNIRVFFAGFSNATIDNSILLRVG
VPTVKDFLTNHYLHFLRIASSQLTGLGTAVQLYAAYEENNRTFLLAAVKRNNNQYVNPSG
VATFFESIKEILLRQSGVKVESVDHDPCIHGPCQNGGSCLRRLAVGSALKIQESLPVVIV
ANEPLQPSQCKCVPGYAGSWCEVDIDECLPAPCHNGGTCHNLVGGFSCSCPEGFTGRACE
RDINECLPSPCKHGAICQNFPGGFNCVCKTGYTGKICESSVNYCECNPCFNGGSCQSGVE
SYYCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQ
TGERAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGQFHTVIARRAGMAASLTVDSC
SENQEPGYCAVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCIMEFA
VNGRPLEPSQALTAQGILDQCPRLEGTCARNPCQHGGTCVDFWSWQQCQCMEGLTGKYCE
KSVTPDTALSLEGKGRLDYHMSQSEKREYLLTQSIRDTTLEPFGVNSLEVKFRTRSENGI
LIHIQESSNYTTVKIKNGKVHFTSDAGVAGKVERIIPEAYIADGHWHTFRISKNGSSTLL
SVDRIHNRDIVHPTQDFGGIEVLSMSLGGIPPNQAHRDTQTGFNGCIASVLYGGESLPFS
GKHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYKCVPPGDCASHPCQNGG
SCEPGLLSGYTCSCPESHTGRTCETVVACLGVLCPQGKVCKAGSPGGHVCVQSQGPDEIS
LPLWAVPAIVGSCATALALLVLSLILCNQCRGKMPKNPKEEKKPKEKKKKGSENVAFDDP
DNIPPYGDDLAVRKQPEGNPKPDIIERENPYLIFDETDIPHNSETIPSAPLASPEQEIEH
YDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSSY
GQGLRTSSLSHSACPTPNPLSRHSPAPFSKPSAFYRNSPARELHLPLRDGGTLEMHGDPC
QPGMFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIAQIPLESSPPVGLSIEEVERLNTP
RPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHDSFTCSEMEYDRE
KPVVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTPAAASGAADSTLK
LGQQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAGNEEGKSGAAKPAAKDGEAEQY
V
NT seq 14946 nt   +upstreamnt  +downstreamnt
atgaacttggctgcaaacctggctcctggccgcaggcggatcctgctaccctctccatct
ctgtgtcagctcctgagagtctgggggctgctgtcgctgctcccaggctctgcccgagtc
caagcggccgaacaccgtcaggtcttccaggtgatggaagagcagcccccagggactctg
gtgggcaccatctcaacgcgtcctggcttcacctatcggctcagtgaaagccacgccctg
ttcgcgattaacagcagcaccggagctttgtacaccacagctaccatcgaccgcgagagc
ctgcccagcgatgtggtcaacctggtggtcctttccagctcccccacataccctaccgag
gtgagagtgctggtgcgtgacctcaacgacaacgccccagtcttcccagacccctcgatc
gtggtcaccttcaaggaggacagtggtagcgggcgtcaggtcattctggacaccgccacg
gactctgacatcggctccaacggtgtggaccaccgctcctaccgcatcgttagtggcaac
gaggcgggccgctttcgcctggacatcaccttgaaccccagtggcgagggagcgttcctg
cacctggtgtccaagggcgggctggaccgcgaggtcacacctcagtaccagctcctggtg
gaggtggaggacaagggtgagccaaagcgtcggggttaccttcaggtcaacgtgactgta
caggacattaacgacaatcccccggtgtttggcagttcccattaccagacgggggtgcct
gaagacgcagtggtgggctccagtgtcctgcaggtggcggcggcggacgcagacgagggc
accaatgcagacatccgttaccggctgcaagatgagggaacccccttccagatggaccca
gagacagggctcatcaccgtgagagagccgctagatttcgaggccaggcgacagtattct
ctgacagttcaggccacggaccggggcgtgccctctctcacagggcgcgccgaagcgctt
atccagctgctggatgtcaatgacaatgacccggtagtgaagtttcgctacttccctgcc
acctcgcgctatgcttcggtggatgagaatgcgcaggtgggtaccgtggtggctctgctc
accgtgactgacgctgactccccagcagccaacggaaacatttcagtgcagattctcggg
ggtaatgagcagcgccactttgaggtacagaggagcaaggtgcccaacctgagcctcatc
aaggtggccagcgccctggaccgggagcgcatcccttcttacaacctcactgtctcagtc
tcggataactccggggcgccccctaccgccgaggtccaggcgcgctcgtctgtggccagc
ttggtgatttttgtcaatgacatcaatgatcaccctccggtatttgagcagcaagtgtac
agagtgaacctgagcgaggaggtgcctccggggagctacgtgagtggggtgtcggccacc
gatggcgactctggtctgaatgctaacctgcgttatagcattgtctccggaaatgggttg
ggctggtttcacattagtgagcacagtggcctggtaactaccagtgctgctggaggcctt
gaccgtgaacttgcttcccagattgtactaaatattagtgcccgagaccagggggtccac
cccaaggtatcctatgcccagcttgtggtaactgtcctggatgtcaatgatgaaaagccg
gcgtttagccagcctgaaggttatgaggtgtctgtggttgaaaatgctccaattgggaca
gagttgttggttcttggggcaacagacagggatctgggtgacaatgggacagtgcgcttc
tccctgcaagaggcagagggtgaccaaaggctcttccgcctggatccagtatctgggagg
ctgagtactatctcctccctggacagagaggaacaggccttctactgtctatcgattcta
gccacagacctgggttcccctccccagtcctccacagctcaggtaaatgtcagtcttcta
gatataaacgacaatagccctgtgttctacccagtccaatacttcgctcatatccaggaa
aatgagcctggaggtagctatgtcaccaccgtgtctgctaccgacccagacatgggtccc
aacggaactgttaagtatagtatatcagctggggacaggtctcggtttcagattcatgcg
aagagtggggtcatttctacaaaaatggccctagatagagaagagaaaacagcataccag
ctgcaagtagtggccacagatgggggcaatctacagtctcccaaccaggccatcgtaact
gtcacggtgttagacacacaagacaacccacccgtgttcagccaggccgcctacagcttt
gtggtctttgagaatgtggctctggggtatcatgtgggcagtgtttctgcaactaccatg
gacctcaatgccaacatcagttatctcatcactaccggggaccagagagggatgtttgct
atgaatcccatcacagggcagctgaccacagcaagtgtcattgacagggaagagcagtcc
ttttaccagctgagagtagtggccagtgggggggccatcacgggagacactgtggttaac
atcacagtgaaagatttgaacgacaatgccccccacttcctccagtccgtggaaagcatc
aatgctgtggagaactggcaggcgggacacagcatcttccaggccaaagccatggacccg
gatgagggtgtcaacggtagagtgctctatagcctgaagcagaaccccaagaacctgttt
actattaatgagcagaatggtaacattagtctgctgggggccctagatgtccattctggg
tcataccaggtagaaatcgtggcctctgatatgggtgtccctcagctgtcctccagcatc
cttctgacagtttacgtccatgatgtaaatgacaacccaccagtgtttgatcagatttcc
tatgaggtcacactctctgagtcagagcctgtgaattctcgattctttaaagtacaagct
tcggacaaagattctggagcaaatggggaaatagcatatgcgatcacagatgggaacaac
ggggatgcctttggcatattcccagatggccagctgtatataaaaagtgaactggatcgt
gaacttcaggacagatacgtgttactggttgttgcctccgaccgggcagtggagcctcta
agtgctactgtgaatgtcactgtgcttttagaagatgtgaatgacaacaggcctttgttt
aatagcaccaattacacattttacttcgaagaggagcagagagctgggtccttcgtaggc
aaagtcagtgctgtggacaaagactttgggccgaatggggaagtaaggtatgcttttgaa
gtggcgcagccaaattttgagttgcatgccatcactggggagataaccaacactcacaag
tttgacagggagtccctcatgaggagaagggggacagcagtgttcagcttcacagtgata
gccatggatcagggcctccctcagcccctcaaggaccaggccactgtgcatgtctacatg
aaggacatcaatgataatgcccccaagtttctaaaagacttttaccaagctacaatatcc
gagacggcgaccaatctgacccaggtcttgcgagtgtctgcctccgacgtggacgaggga
agcaatggtctcattcactactctatcctcaaaggaaatgaagaaagacagtttgccata
gacagcctctccggtcaggtgactctcgtaggcaagctagactatgaaacgacctcagcc
tattctctcctcatccaggcagtggattcgggggccatccccctcaactcgacctgcacc
ctgagtatcgatattttggatgagaatgataacactccctctttcccaaagtcaacacta
tttgtggatgttttggaaaacatgaggattggtgaacttgtatcctctatcacggccact
gactctgactcgggtgtcaatgccgacctacactacactattacagggtcaaacaaccac
gggacttttagtattagccccaacaccgggagtatctttctagccaaaaagttggacttt
gagacacagtctttatataaattaaacataacagcgaaagaccaggggcggcctcctcga
tcatccacgatgtcagtggtgatccaggtgagggacttcaatgacaacccccccagcttt
cctccgggagacatttttaagtccatagtcgagaacatcccccttggtacgtctgtaatt
tctgtgacggcacatgacccagatgcggatatcaatgggcagttgtcttacgccatcatc
caacagatgccccgaggcaaccacttcagcatagacgaagtcaaaggaaccatctacacc
agtgctgagatcgaccgggaatttgccaacctctttgagttaacggtgaaagccaatgac
caagcagtgccgatagaaaccaggaggtatgctttgaaaaatgtgaccatcttggtgacc
gacctcaacgacaatgtcccaatgtttatatcccaaaatgcactggctgcagacccttca
gccatgatcggttctgtcctgacgaccatcatggctgcagacccagatgaaggtgccaat
ggtgaggtggagtatgagatactcaatggggacacagacaccttcactgtggatcgttac
agtggagaccttcgagtggcttctgccttggtgccttcacagctcatctacaacctcata
gtatcagccacagacctgggcccagagcggaggaagtcgaccacagagctcactgtcatc
ctccagggcctagatgggcctgttttcacacagaccaaatacataaccatcttgaaggaa
ggggagcccattggcaccaatgtcatctccatagaagcagccagccccagagggtcagaa
gctccagtggaatattacatcgtttctgttcgttgtgaagagaagactgttggacgtctc
tttaccattggacggcagacaggtgtcattcaaactgcagccattttggaccgggagcag
ggagcgtgtctctacctggtggatgtctatgccatagagaagtcctctgcctttcccagg
acacagagagcagaggtagaaataacacttcaagatatcaatgacaacccaccagtgttt
ccaacagacaccctggatctcactgtggaagagaacattggagatggctcgaagattatg
cagctgactgctatggatgcagatgagggtgccaatgctctggtcacgtatgctctcatt
agtggagctgatgacagcttccgaattgaccctgagtctggagacctgatagccaccaag
aggttggacagggagcacaggtccaagtactcactgctggttcgtgcagacgacggcctc
cagtcctcagacatgaggataaacatcaccatcagcgacgtgaatgaccacacccccaga
ttctccagacccgtgtactcgtttgacatccccgaagacacaacccctggttccctggtg
gcagctattttagcaacagatgacgactctggtgtgaatggagagatcagctatgtggtg
gaggaggatgatggggatggcgtgttctttctgaatccagtcactggtgtcttcaacctg
acccgagcactggactatgaaatgcagcagtattacatcctcacggtccatgcggaggac
ggtgggggtcagttcaccactgtccgagcttacttcaacattcttgatgttaatgacaat
ccacctgtcttcagcatgagctcctatagcacatccttaatggaaaacctgcctctcgga
tccactgtccttgtgtttaacgtcaccgatgcagatgacggtgtcaattctcaactgtcc
tacagcatcgcttcaggtgacagccttgggcagtttgcagtggataagcacggcatcctc
aaagccctcaaagctttggaccgggaaagccagtccttctacaacctggtcattcaggtt
cacgacctgccccagcctcctgcctccaggttcacaagcacagcgcaagtctctatcatt
ttattagatgtcaatgataacccacctatgtttctttcccccaagttgacgtacattcca
gaaaacacacctattgatactgttgtcttcaaggctcaagcgacagacccagacagtggc
cccaacagttatattgagtatactctcctgaacccttcaggaaacaagttcagcattggg
accattgatggtgaggtacatctcactggagagctggacagagaggaagtttccaattac
agcctgacagtggtggccacagacaaagggcagccacctctgtcgtcctctactgaggtt
gtggttatggtccttgacatcaacgataacaaccctgtttttgctcaggctgtgtaccga
gtgcaggttaaggaggacatactcactggaacagatataatccaagtgtctgcagcagac
aatgatgaaggtaccaacgggcaggttcgctatggcatcgtgggtggaaacacgcatcag
gagttcaggatcgactcagtgacaggggccatcacagtggctaagtctttggatagagag
atgatccctgcttacactttaactgttcaagccacggatcggggcagtagccccagaatg
gactcctgcacggtcaccatcacattacttgacatgaatgattttgtccctgtattcgag
ctgtctccgtattctgtgaatgttcctgaaaatttagggaccctgcccagaaccattctt
caggtggtggcaagagatgatgatcaaggtccaaatagccagctctcatatgttttgctt
ggtggaaatgaagacaatgcttttgccctcacggccagtggcgagcttcgggtgacccag
agtctggaccgggaagcaagagatcacttcgtcctggttgtcacagctgctgatgcagga
tccccagccttgacgggaacaggaacaatcaacatcattgtagatgatatcaacgacaat
gtccccactttcgccaataacatgtacttaacttcaattcccgaggatgcccggacgggg
acagatgtcctgttggtgaatgcctcagatgcagatgctgcagcaaatgctgtcatcagt
tacagtatcatcggtggaaactcgcagttcaccatcaacccatccacgggacagatcatc
actagtgctttgctggacagagaaaccaaagataattacactttggtcgtggttgccagt
gatgctgggtcaccagtgtctctttccagctctactagtgtgcttgtgaccatcacagat
gttaatgacaacccaccccggttccaacatcacccctatgtcacacacgtcccatctcct
actcctccaggttcctttgtttttgccgtcacagtcaccgacgctgacatcggatctaat
tctgaactccattactcactctcaggtagaaactctgaaaaatttcacattgaccccctg
aggggggcaatcatggcagctgggccactaagcggagcttcggaggtgacgttctctgtc
cacgtgaaagatggtggctcatttccaaagacagattctactacagtgactgttaggttt
gccaacaaggcagatttccccaaagtcagagccaaagaacaaacattcatgtttccagaa
aaccagccagtgggcactctggtcaccaccatcacagggtcctctttgagaggagaaact
ttgtcctactacattgcaagtgggaacctgggcgacactttccaaattgatccactaaca
ggacaggtgtccatcagccagcctttggactttgagaagatacaaaaatacgttgtttgg
atcgaagctagagatggaggctttcctcccttctcatcttacgagaaacttgacatcacg
gtgctagatatcaatgacaatgctccagctttcgaagaggatccgtttgtgtctgagatc
ctggaaaacctatcccctcggaaaatccttaccgtctcagcaacagataaggacagtggt
cccaatggacagctagactatgagattgtgaatggcaaccaggagcgcagtttcacgatc
aatcacgctacaggtgaaatcagaagcatccggccactagacagagaaaaaatatcccac
tatgagctcactgtgaaatcttcagacaaagggtccccttctcagagcacctccgtcaaa
gtgatcatcagtattttagatgaaaatgataacgcacctaggttttctcagatattcagt
gcctatgtttccgaaaactcccccttgggatacacagttacccgtgtaacaacttccgat
gaagacattgggataaatgcaattagtagatattccatagtggacacaagtcttccattt
accatcaaccccaacacaggagatattgtcatcagtcgacctttaaacagagaagataca
gacagatacaggatccgagtgtccgcacatgattctggctggaccgtaagtaccgatgtc
accatattcgtgactgacatcaatgacaacactccaagatttagcagaccctcttattat
ttagattgccctgaacttcctgagctaggctccagagtaactcaggtgtccgccacagat
cccgatgaggggtcaaatggacaggtgttttatttcataaagtcgcagtcagagtatttc
cgaatcaatgccaccactggagagattttcaacaagcaggtgttaaaataccaaaacgtc
agtggcttcagtaatgtgaacatcaacaggcacagtttcattgtgacagcttctgaccga
ggcaacccctccttactcagcgagaccacggttaccatcaacacggtggatagcaacgac
aacccacctcagtttctccaaaataaatactttaccccagttaccaaaaacgtcaaagtt
ggtactaagttgatcaaagtgactgcggtggatgacaaagactttggattaaactctgaa
gtggagtatttcatgttggatgggaaccacctggggaagtttaagttagacaacgatact
gggtggatttcaatagcctcttccttggtttctgacctaaatcaaaacttcctgatcaga
gtcacagcaaaggacaaagggaaccccccgctttcctcccaagcagtcgttcacatcaca
gtcactgaagagaactaccacacccctgaattttcccagaaccatataagtgccaccatc
cctgagagccacagcattgggtctgtggtcagaactgtctctgccagagatcgtgacaca
gccatgaacggtctgatcagttacaacatttcttcggggaatgaagagggcatctttgca
atcaattcctcaacaggtgtggtaaccctagccaaagccctcgattatgagttgagctcc
aagcacgagatgaccataagtgccacagatggaggatgggttgcgaggactggctactgc
agcctgactgtgagtgtgatcgatgtgaatgacaattccccagtgtttgttcctgatgaa
tttttcccaactgttttggagaatgccccgagtgggaccactgttatccacctaaacgca
acagatgctgactcgggagccaatgctgtgatcgcgtatactgtgcagtcatcagacagt
gacctgtttgttattgaccccaacacgggggtcatcaccactcaaggcttcttggatttt
gaaaccaagcagagctatcacctcacagtgaaagccttcaacgtccccgatgaggaaaag
tgcagctttgccactgtggacatccagttgaaggggacgaatgagtatgtgcctcgcttt
gtctctaagctctactactttgaggtgtcagaagcggcttctagggggactgctgttggg
gaagtgtttgccagtgacagggacatgggtgctgatggagaagtgcactatttgatcttt
ggaaacagcaggaagaagggcttccagatcaacaagatgacagggcagatctatgtgtct
gggcttcttgatagagagaaagaagaaagggtgtctttgaaagtgttggccaagaacttt
ggcaacattcggggtgcagacattgatgaagtcacagtgaacatcactgtgcttgatgct
aatgacccgccagtgtttagtctgaacacctatagagtccagatcagtgaaggtgtccct
attgggactcacgtgacctttgtgagtgcctttgactcagattccattcctagctggagc
aggttctcatacttcattgggtccgggaacgaaaacggtgccttttccattaacccacag
acagggcagatcacagttacctcagggctggaccgggaaagcctgcctgtttataatctc
actgtcctggctgtagactcagggactccctctgccacagggagtgcttccttgttagtt
accctggaagacatcaatgacaatggcccagtgttgactgtcagtgaaggggaagttcta
gaaaacaaacgcccaggaacactagtgatgaccctgcagtccacagatcctgacctccct
ccaaatcaaggccccttcaattattacctgctgagcacaggccccgctactaattatttc
agtctcagcaccactggagttctaagcacaacccgggagattgacagagagcagattgcg
gacttctatctgtctgtggtcaccagggattctggggctcctcagatgtcatccacagga
actgtgcacatcactgttctagatcaaaatgacaacccctcacagtcccgcacagtggag
atatttgttaattattacggcaacttatttcctggtgggactctcggctctgtgaagccc
caggatccggatgtgttagacagtttccactgctccctcacttcaggagtcaccagcctc
ttcagtatcccagcgggcagctgtgacctgagttcccagcccagatccacagacggcacc
ttcgatctgactgttgtcagcagcgatggggttcacagcacagtcaccaacaatatccga
gttttctttgcaggattctccaatgctacaatagataacagcatcttgcttcgtgttggt
gttcccaccgtcaaggacttcctgactaatcactaccttcactttctgcgcattgctagt
tcccagcttacggggctgggcaccgcagtgcagctgtatgctgcctacgaggagaacaac
agaacgtttcttttagcagctgtgaaacgaaataataaccagtatgtgaaccccagtggt
gtagccacgttcttcgaaagcatcaaagagatcctcctccgtcagagtggtgtcaaggtc
gaatctgtggatcatgacccgtgcattcatgggccatgtcagaacggaggcagctgcctt
cgaaggcttgctgtgggctctgcgctgaagatccaggagagcctgcctgtcgtcatcgtg
gccaatgagcctctgcagccttcccagtgcaagtgtgtgccaggctatgctggaagctgg
tgtgaagtggatattgatgaatgcctcccggccccttgccacaatgggggcacctgccac
aacttagttgggggattttcatgtagctgcccagagggctttactggaagagcctgtgag
agagacatcaatgaatgtctgcccagcccttgcaagcatggggccatctgtcaaaatttc
ccagggggattcaactgtgtgtgcaaaactggatatacaggaaagatatgtgaatcttca
gtcaattactgtgaatgcaatccctgcttcaatggtggttcctgtcagagtggtgtggaa
tcctattactgtcactgtccattcggtgtctttggcaagcactgtgagctgaacagttat
ggatttgaggaactgtcatacatggagtttcccagcctggaccccaacaacaactatatt
tatgtcaagtttgcgaccatcaaaagtcatgctttattgctttataactatgacaaccag
acaggagaacgggcagagttcctggctctggagatcgcagaagaaagactcagattctca
tataatctgggcagtgggacgtacaaactgaccaccatgaagaaggtgtcggatggacag
ttccacacagtgattgcgcggcgagcaggcatggcagcttctttaactgtggactcctgc
tcagagaatcaagagccaggctattgcgctgtcagtaatgtggcggtttcagacgactgg
actcttgatgttcagccaaaccgagtcactgttggaggaatcagatcactagagccaatc
cttcagaggagggggcatgtggagagccacgattttgtgggctgtataatggagttcgct
gtcaatggacgacccctggagcccagccaggctctgacagcacaaggcattcttgatcag
tgtcctagattagaaggcacgtgtgctcgcaacccctgccagcatggtggcacctgtgtg
gacttctggtcatggcaacagtgtcagtgcatggagggcctgactgggaagtactgtgaa
aaatctgtcactccagacactgccttgtcactagaaggcaaaggacgcctggactaccac
atgagccagagtgaaaagcgggaatacttgctgacacagagcatacgggacaccacattg
gagccttttggggtcaatagcctggaagtaaaattcaggactcggagtgagaatggtatt
ttgatccatatccaggaaagcagcaattataccacagtgaagattaagaatggcaaagtg
cactttacgtcagacgcaggtgttgctgggaaagtggagcgaatcattccagaagcatac
attgcagatggccactggcacaccttccggatctcaaagaatgggagcagcaccctgctg
tctgtagataggatacacaacagggacatcgtccaccccacgcaggacttcggtggcatc
gaggtgctttccatgtctctgggaggaatcccccccaaccaagcccatcgagacacccag
acaggttttaatggctgcatcgcctcagtgctctatggcggagagagcctccccttcagt
gggaagcacagcttggcttccatctccaaaaccgacccttcagtgaagataggttgtcgg
ggccccaacatctgtgccagcaacccctgctggggcgatcttctgtgtatcaaccagtgg
tatgcctacaaatgtgtccctcctggtgactgcgcatcccacccttgccagaatggaggt
agctgtgaaccaggtctgctctctggctacacttgcagctgtccggagtcgcacacgggg
aggacctgtgagacggtggtggcctgcctcggtgttctctgtcctcagggcaaggtgtgc
aaggctggaagtcccgggggacacgtgtgtgtccagagtcagggtccagatgagatctcc
ttacctctttgggcggtgcctgcaattgtgggcagctgtgccacagcccttgcgctactc
gtcctcagtttgattctatgcaaccagtgcaggggaaagatgcccaaaaaccccaaagag
gagaagaagccgaaggagaagaagaagaagggcagtgagaatgtagcttttgatgaccca
gacaacatccctccctatggggatgacctagctgttaggaagcaacctgaggggaatccc
aagccagacatcatagagcgagagaatccctatctaatcttcgatgagactgacatcccc
cacaactcagagaccatccccagtgccccgctggcttccccagagcaggagattgagcac
tatgacatcgacaatgccagcagtatcgcgccctcagatgcagacatcatccagcactac
aaacagttccgaagccacacacctaagttttccatccagaggcacagtcctctgggcttc
gccaggcagtcccctatgcccttgggagcaagcagtctgacctaccagccttcttcatat
ggccaggggttaagaaccagctccctcagccactcggcctgccccactcccaaccctctg
tccaggcacagcccagctcctttctccaaaccatctgccttctacaggaacagcccagcc
cgggaacttcaccttcctctgagggatgggggtactctggaaatgcatggggacccctgc
cagcctggcatgttcaactatgccaccaggctagggagaagaagtaagagccctcaggcc
atggcatctcatggttcgagaccagggagtcgcctcaagcagcccatagcacagatccct
ctagaatcttctcctcccgtgggactctccatcgaggaggtagagaggctcaacacccct
cgtcccagaaaccccagcatctgcagtgcagaccatgggaggtcctcttctgaagaagac
tgtagaagacccctgtccagaaccaggaacccagcagatggcatccctgccccagaatcg
tcttctgacagtgactcccatgattctttcacgtgctcagaaatggaatacgacagggag
aagcccgtggtctacacttccaggatgcccaagttatctcaagtcaacgaatccgatgca
gatgacgaagataattatggagccagactgaaacccagaaggtaccatggacgcagggct
gaagggggaccagtgggtacccctgcagcagcgtctggggctgcagacagcaccctgaag
ctggggcagcaggcaggcaacttcaactgggacaaccttttgaactggggcccaggcttt
ggtcactatgtggatgtctttaaagatttggcctctctcccagaaaaagcagctggtaac
gaagaaggtaaaagtggggcagctaaaccagccgccaaagatggggaggcagaacagtat
gtgtga

DBGET integrated database retrieval system