KEGG   Mus pahari (shrew mouse): 110320020
Entry
110320020         CDS       T05929                                 

Gene name
Mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110320020 (Mapk3)
   04012 ErbB signaling pathway
    110320020 (Mapk3)
   04014 Ras signaling pathway
    110320020 (Mapk3)
   04015 Rap1 signaling pathway
    110320020 (Mapk3)
   04350 TGF-beta signaling pathway
    110320020 (Mapk3)
   04370 VEGF signaling pathway
    110320020 (Mapk3)
   04371 Apelin signaling pathway
    110320020 (Mapk3)
   04668 TNF signaling pathway
    110320020 (Mapk3)
   04066 HIF-1 signaling pathway
    110320020 (Mapk3)
   04068 FoxO signaling pathway
    110320020 (Mapk3)
   04072 Phospholipase D signaling pathway
    110320020 (Mapk3)
   04071 Sphingolipid signaling pathway
    110320020 (Mapk3)
   04024 cAMP signaling pathway
    110320020 (Mapk3)
   04022 cGMP-PKG signaling pathway
    110320020 (Mapk3)
   04151 PI3K-Akt signaling pathway
    110320020 (Mapk3)
   04150 mTOR signaling pathway
    110320020 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110320020 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110320020 (Mapk3)
   04210 Apoptosis
    110320020 (Mapk3)
   04218 Cellular senescence
    110320020 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110320020 (Mapk3)
   04520 Adherens junction
    110320020 (Mapk3)
   04540 Gap junction
    110320020 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110320020 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110320020 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110320020 (Mapk3)
   04613 Neutrophil extracellular trap formation
    110320020 (Mapk3)
   04620 Toll-like receptor signaling pathway
    110320020 (Mapk3)
   04621 NOD-like receptor signaling pathway
    110320020 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    110320020 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    110320020 (Mapk3)
   04660 T cell receptor signaling pathway
    110320020 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    110320020 (Mapk3)
   04659 Th17 cell differentiation
    110320020 (Mapk3)
   04657 IL-17 signaling pathway
    110320020 (Mapk3)
   04662 B cell receptor signaling pathway
    110320020 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    110320020 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    110320020 (Mapk3)
   04062 Chemokine signaling pathway
    110320020 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110320020 (Mapk3)
   04929 GnRH secretion
    110320020 (Mapk3)
   04912 GnRH signaling pathway
    110320020 (Mapk3)
   04915 Estrogen signaling pathway
    110320020 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    110320020 (Mapk3)
   04917 Prolactin signaling pathway
    110320020 (Mapk3)
   04921 Oxytocin signaling pathway
    110320020 (Mapk3)
   04926 Relaxin signaling pathway
    110320020 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    110320020 (Mapk3)
   04919 Thyroid hormone signaling pathway
    110320020 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    110320020 (Mapk3)
   04916 Melanogenesis
    110320020 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110320020 (Mapk3)
   04270 Vascular smooth muscle contraction
    110320020 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110320020 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110320020 (Mapk3)
   04725 Cholinergic synapse
    110320020 (Mapk3)
   04726 Serotonergic synapse
    110320020 (Mapk3)
   04720 Long-term potentiation
    110320020 (Mapk3)
   04730 Long-term depression
    110320020 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    110320020 (Mapk3)
   04722 Neurotrophin signaling pathway
    110320020 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    110320020 (Mapk3)
   04380 Osteoclast differentiation
    110320020 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110320020 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320020 (Mapk3)
   05206 MicroRNAs in cancer
    110320020 (Mapk3)
   05205 Proteoglycans in cancer
    110320020 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    110320020 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    110320020 (Mapk3)
   05203 Viral carcinogenesis
    110320020 (Mapk3)
   05230 Central carbon metabolism in cancer
    110320020 (Mapk3)
   05231 Choline metabolism in cancer
    110320020 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110320020 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110320020 (Mapk3)
   05212 Pancreatic cancer
    110320020 (Mapk3)
   05225 Hepatocellular carcinoma
    110320020 (Mapk3)
   05226 Gastric cancer
    110320020 (Mapk3)
   05214 Glioma
    110320020 (Mapk3)
   05216 Thyroid cancer
    110320020 (Mapk3)
   05221 Acute myeloid leukemia
    110320020 (Mapk3)
   05220 Chronic myeloid leukemia
    110320020 (Mapk3)
   05218 Melanoma
    110320020 (Mapk3)
   05211 Renal cell carcinoma
    110320020 (Mapk3)
   05219 Bladder cancer
    110320020 (Mapk3)
   05215 Prostate cancer
    110320020 (Mapk3)
   05213 Endometrial cancer
    110320020 (Mapk3)
   05224 Breast cancer
    110320020 (Mapk3)
   05223 Non-small cell lung cancer
    110320020 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320020 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    110320020 (Mapk3)
   05161 Hepatitis B
    110320020 (Mapk3)
   05160 Hepatitis C
    110320020 (Mapk3)
   05171 Coronavirus disease - COVID-19
    110320020 (Mapk3)
   05164 Influenza A
    110320020 (Mapk3)
   05163 Human cytomegalovirus infection
    110320020 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110320020 (Mapk3)
   05165 Human papillomavirus infection
    110320020 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110320020 (Mapk3)
   05135 Yersinia infection
    110320020 (Mapk3)
   05133 Pertussis
    110320020 (Mapk3)
   05152 Tuberculosis
    110320020 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110320020 (Mapk3)
   05140 Leishmaniasis
    110320020 (Mapk3)
   05142 Chagas disease
    110320020 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110320020 (Mapk3)
   05020 Prion disease
    110320020 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    110320020 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    110320020 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110320020 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110320020 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110320020 (Mapk3)
   04934 Cushing syndrome
    110320020 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320020 (Mapk3)
   01524 Platinum drug resistance
    110320020 (Mapk3)
   01522 Endocrine resistance
    110320020 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110320020 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110320020 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320020 (Mapk3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110320020 (Mapk3)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110320020 (Mapk3)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110320020 (Mapk3)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110320020 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 110320020
NCBI-ProteinID: XP_021051518
Ensembl: MGP_PahariEiJ_G0013671
LinkDB
Position
1
AA seq 380 aa
MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPEGP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctccggggggcgggggcggggagcccaggggaactgctggg
gtcgtcccggtggtcccgggggaggtggaggtggtgaaggggcagccattcgacgtgggc
ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tatgaccacgtgcgcaagaccagagtggccatcaagaagatcagcccctttgagcatcaa
acctactgtcagcgcacactgagggagatccagatcttgctgcgattccgccatgagaat
gtcataggcatccgagacatcctcagagcacccaccctggaagccatgagagatgtttac
attgttcaggacctcatggagacagacctgtacaagctgctaaaaagccagcagctgagc
aatgaccacatctgctacttcctctaccagatcctccggggcctcaagtacatacactcg
gccaatgtgctgcaccgggacctgaagccctccaatctgcttatcaacaccacctgcgac
cttaagatctgtgattttggcctggcccggattgctgaccctgagcatgaccacactggc
tttctgacggagtatgtggccacacgctggtaccgagccccagagatcatgcttaactcc
aagggctacaccaaatccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctaggt
attctgggttccccgtcccaggaggaccttaattgcatcattaacatgaaggcccgaaac
tacctacagtctctgccctcgaaaaccaaggtggcttgggccaagctctttcctaaatct
gactccaaagctcttgacctgctggaccggatgttaaccttcaacccaaacaagcgcatc
acagttgaggaagcactggctcacccttacctggaacagtactatgatccaacagatgag
ccagtggctgaggagccgttcaccttcgacatggagctggacgacctccccaaagaacgg
ctgaaggagctcatcttccaagagacagcccgcttccagccgggggcgccagagggcccc
taa

KEGG   Mus pahari (shrew mouse): 110329343
Entry
110329343         CDS       T05929                                 

Gene name
Mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110329343 (Mapk1)
   04012 ErbB signaling pathway
    110329343 (Mapk1)
   04014 Ras signaling pathway
    110329343 (Mapk1)
   04015 Rap1 signaling pathway
    110329343 (Mapk1)
   04350 TGF-beta signaling pathway
    110329343 (Mapk1)
   04370 VEGF signaling pathway
    110329343 (Mapk1)
   04371 Apelin signaling pathway
    110329343 (Mapk1)
   04668 TNF signaling pathway
    110329343 (Mapk1)
   04066 HIF-1 signaling pathway
    110329343 (Mapk1)
   04068 FoxO signaling pathway
    110329343 (Mapk1)
   04072 Phospholipase D signaling pathway
    110329343 (Mapk1)
   04071 Sphingolipid signaling pathway
    110329343 (Mapk1)
   04024 cAMP signaling pathway
    110329343 (Mapk1)
   04022 cGMP-PKG signaling pathway
    110329343 (Mapk1)
   04151 PI3K-Akt signaling pathway
    110329343 (Mapk1)
   04150 mTOR signaling pathway
    110329343 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110329343 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110329343 (Mapk1)
   04210 Apoptosis
    110329343 (Mapk1)
   04218 Cellular senescence
    110329343 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110329343 (Mapk1)
   04520 Adherens junction
    110329343 (Mapk1)
   04540 Gap junction
    110329343 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110329343 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110329343 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110329343 (Mapk1)
   04613 Neutrophil extracellular trap formation
    110329343 (Mapk1)
   04620 Toll-like receptor signaling pathway
    110329343 (Mapk1)
   04621 NOD-like receptor signaling pathway
    110329343 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    110329343 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    110329343 (Mapk1)
   04660 T cell receptor signaling pathway
    110329343 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    110329343 (Mapk1)
   04659 Th17 cell differentiation
    110329343 (Mapk1)
   04657 IL-17 signaling pathway
    110329343 (Mapk1)
   04662 B cell receptor signaling pathway
    110329343 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    110329343 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    110329343 (Mapk1)
   04062 Chemokine signaling pathway
    110329343 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110329343 (Mapk1)
   04929 GnRH secretion
    110329343 (Mapk1)
   04912 GnRH signaling pathway
    110329343 (Mapk1)
   04915 Estrogen signaling pathway
    110329343 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    110329343 (Mapk1)
   04917 Prolactin signaling pathway
    110329343 (Mapk1)
   04921 Oxytocin signaling pathway
    110329343 (Mapk1)
   04926 Relaxin signaling pathway
    110329343 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    110329343 (Mapk1)
   04919 Thyroid hormone signaling pathway
    110329343 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    110329343 (Mapk1)
   04916 Melanogenesis
    110329343 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110329343 (Mapk1)
   04270 Vascular smooth muscle contraction
    110329343 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110329343 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110329343 (Mapk1)
   04725 Cholinergic synapse
    110329343 (Mapk1)
   04726 Serotonergic synapse
    110329343 (Mapk1)
   04720 Long-term potentiation
    110329343 (Mapk1)
   04730 Long-term depression
    110329343 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    110329343 (Mapk1)
   04722 Neurotrophin signaling pathway
    110329343 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    110329343 (Mapk1)
   04380 Osteoclast differentiation
    110329343 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110329343 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329343 (Mapk1)
   05206 MicroRNAs in cancer
    110329343 (Mapk1)
   05205 Proteoglycans in cancer
    110329343 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    110329343 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    110329343 (Mapk1)
   05203 Viral carcinogenesis
    110329343 (Mapk1)
   05230 Central carbon metabolism in cancer
    110329343 (Mapk1)
   05231 Choline metabolism in cancer
    110329343 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110329343 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110329343 (Mapk1)
   05212 Pancreatic cancer
    110329343 (Mapk1)
   05225 Hepatocellular carcinoma
    110329343 (Mapk1)
   05226 Gastric cancer
    110329343 (Mapk1)
   05214 Glioma
    110329343 (Mapk1)
   05216 Thyroid cancer
    110329343 (Mapk1)
   05221 Acute myeloid leukemia
    110329343 (Mapk1)
   05220 Chronic myeloid leukemia
    110329343 (Mapk1)
   05218 Melanoma
    110329343 (Mapk1)
   05211 Renal cell carcinoma
    110329343 (Mapk1)
   05219 Bladder cancer
    110329343 (Mapk1)
   05215 Prostate cancer
    110329343 (Mapk1)
   05213 Endometrial cancer
    110329343 (Mapk1)
   05224 Breast cancer
    110329343 (Mapk1)
   05223 Non-small cell lung cancer
    110329343 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110329343 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    110329343 (Mapk1)
   05161 Hepatitis B
    110329343 (Mapk1)
   05160 Hepatitis C
    110329343 (Mapk1)
   05171 Coronavirus disease - COVID-19
    110329343 (Mapk1)
   05164 Influenza A
    110329343 (Mapk1)
   05163 Human cytomegalovirus infection
    110329343 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110329343 (Mapk1)
   05165 Human papillomavirus infection
    110329343 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110329343 (Mapk1)
   05135 Yersinia infection
    110329343 (Mapk1)
   05133 Pertussis
    110329343 (Mapk1)
   05152 Tuberculosis
    110329343 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110329343 (Mapk1)
   05140 Leishmaniasis
    110329343 (Mapk1)
   05142 Chagas disease
    110329343 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110329343 (Mapk1)
   05020 Prion disease
    110329343 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    110329343 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    110329343 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110329343 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110329343 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110329343 (Mapk1)
   04934 Cushing syndrome
    110329343 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110329343 (Mapk1)
   01524 Platinum drug resistance
    110329343 (Mapk1)
   01522 Endocrine resistance
    110329343 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110329343 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110329343 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110329343 (Mapk1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110329343 (Mapk1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110329343 (Mapk1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110329343 (Mapk1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110329343 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kdo Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 110329343
NCBI-ProteinID: XP_021064575
Ensembl: MGP_PahariEiJ_G0016206
LinkDB
Position
12
AA seq 358 aa
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacaccaacctctcgtacatcggagaaggcgcctacggcatggtttgctctgct
tatgataatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccag
acctactgtcaaagaaccctaagagagataaaaatcttactgcgcttcagacatgagaac
atcatcggcatcaatgacatcatccgtgcaccaaccattgagcaaatgaaagatgtatat
atagtacaggacctcatggagacagatctttacaagctcttgaagacacagcacctcagc
aatgaccatatctgctatttcctttatcagatcctgagaggattgaaatatatccattca
gctaatgttctgcaccgtgacctcaagccttccaacctcctgctgaataccacttgtgat
ctcaagatctgtgactttggccttgcccgtgttgcagatccagatcatgatcacacaggg
ttcttgacagagtacgttgccacacgttggtacagagctccagagattatgttgaattcc
aagggttataccaagtccattgatatttggtctgtgggctgcatcctggcagagatgcta
tccaacaggcctatcttcccaggaaagcattaccttgaccagctgaatcacatcctgggt
attcttggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaac
tatttgctttctctcccgcacaagaataaggtgccgtggaacaggttgttcccaaatgct
gactccaaagctctggatttactggataaaatgttgacatttaatcctcacaagaggatt
gaagttgaacaggctctggcccacccatacctggagcagtattatgacccaagtgatgag
cccattgctgaagcaccattcaagtttgacatggagttggacgacttacctaaggagaag
ctcaaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system