KEGG   Mus pahari (shrew mouse): 110320074
Entry
110320074         CDS       T05929                                 
Symbol
Negr1
Name
(RefSeq) neuronal growth regulator 1 isoform X1
  KO
K06775  neuronal growth regulator 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110320074 (Negr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110320074 (Negr1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  IgLON family
   110320074 (Negr1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Ig_5 Izumo-Ig Ig_4 C2-set_2 V-set_CD47 Adeno_E3_CR1 Ig_C17orf99
Other DBs
NCBI-GeneID: 110320074
NCBI-ProteinID: XP_021051621
Ensembl: MGP_PahariEiJ_G0027212
LinkDB
Position
4:143564546..144282986
AA seq 348 aa
MVLLAQGACCSNQWLAAVLLSLCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGA
SKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTP
RTMQVHLTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEPAISWRHISPSAKPFENGQ
YLDIYGITRDQAGEYECSAENDVSFPDVKKVRVIVNFAPTIQEIKSGTVTPGRSGLIRCE
GAGVPSPAFEWYKGEKRLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTT
NASLPLNPPSTAQYGITGSACDLFSSWSLALTLSSVISIFYLKNAILQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtgctcctggcgcagggcgcttgttgctcgaaccagtggctggcggcggtgcttctg
agcttgtgctcttgcctcccggccgggcagagcgtggacttcccttgggcggccgtggac
aacatgctggtgaggaaaggtgacacggcggtgctcaggtgttacttggaagatggagca
tcaaagggtgcctggctcaacaggtcaagtatcatttttgctggaggtgacaagtggtca
gtagaccctcgagtttccatttccacattgaataaaagagactacagcctccagatacag
aatgttgatgtgacagatgacggcccatacacctgttctgtgcagacccaacacacacca
cggacaatgcaggttcatctcactgtgcaagtccccccgaaaatatacgacatctcaaat
gacatgaccatcaatgaaggaaccaatgtcacccttacttgtttggccactgggaagcca
gagcctgccatttcctggaggcatatctccccatcagcaaaaccatttgaaaatggacaa
tatttggacatttatggaattacaagggaccaggctggggagtatgagtgcagtgcagaa
aacgatgtatccttcccagatgtgaagaaagtgagagtgatcgtgaactttgcgcctaca
attcaggaaattaaatctggcactgtgacccctggacgcagtggactgatacgatgcgag
ggtgcaggtgtgccgtcgccggccttcgagtggtacaaaggagagaagaggctcttcaat
ggccaacaaggaattatcattcagaattttagcacaagatccatcctcacagtgaccaat
gtgacgcaggagcacttcggcaactatacctgtgtggctgccaacaagttgggcacaacc
aacgcgagcctgcccctcaaccctccaagtacagcccagtatggaattactgggagcgcc
tgcgacctcttctccagctggagccttgcgttgacactatcttctgtcatcagtatattc
tacctgaagaatgccatcctacaatga

DBGET integrated database retrieval system