KEGG   Mus pahari (shrew mouse): 110320075
Entry
110320075         CDS       T05929                                 

Gene name
Prkcb
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04062  Chemokine signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04150  mTOR signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04662  B cell receptor signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04931  Insulin resistance
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05140  Leishmaniasis
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05214  Glioma
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
mpah05231  Choline metabolism in cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110320075 (Prkcb)
   04012 ErbB signaling pathway
    110320075 (Prkcb)
   04014 Ras signaling pathway
    110320075 (Prkcb)
   04015 Rap1 signaling pathway
    110320075 (Prkcb)
   04310 Wnt signaling pathway
    110320075 (Prkcb)
   04370 VEGF signaling pathway
    110320075 (Prkcb)
   04064 NF-kappa B signaling pathway
    110320075 (Prkcb)
   04066 HIF-1 signaling pathway
    110320075 (Prkcb)
   04020 Calcium signaling pathway
    110320075 (Prkcb)
   04070 Phosphatidylinositol signaling system
    110320075 (Prkcb)
   04071 Sphingolipid signaling pathway
    110320075 (Prkcb)
   04150 mTOR signaling pathway
    110320075 (Prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110320075 (Prkcb)
   04540 Gap junction
    110320075 (Prkcb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110320075 (Prkcb)
   04650 Natural killer cell mediated cytotoxicity
    110320075 (Prkcb)
   04662 B cell receptor signaling pathway
    110320075 (Prkcb)
   04666 Fc gamma R-mediated phagocytosis
    110320075 (Prkcb)
   04670 Leukocyte transendothelial migration
    110320075 (Prkcb)
   04062 Chemokine signaling pathway
    110320075 (Prkcb)
  09152 Endocrine system
   04911 Insulin secretion
    110320075 (Prkcb)
   04929 GnRH secretion
    110320075 (Prkcb)
   04912 GnRH signaling pathway
    110320075 (Prkcb)
   04921 Oxytocin signaling pathway
    110320075 (Prkcb)
   04935 Growth hormone synthesis, secretion and action
    110320075 (Prkcb)
   04918 Thyroid hormone synthesis
    110320075 (Prkcb)
   04919 Thyroid hormone signaling pathway
    110320075 (Prkcb)
   04928 Parathyroid hormone synthesis, secretion and action
    110320075 (Prkcb)
   04916 Melanogenesis
    110320075 (Prkcb)
   04925 Aldosterone synthesis and secretion
    110320075 (Prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110320075 (Prkcb)
  09154 Digestive system
   04970 Salivary secretion
    110320075 (Prkcb)
   04971 Gastric acid secretion
    110320075 (Prkcb)
   04972 Pancreatic secretion
    110320075 (Prkcb)
   04973 Carbohydrate digestion and absorption
    110320075 (Prkcb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110320075 (Prkcb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110320075 (Prkcb)
  09156 Nervous system
   04724 Glutamatergic synapse
    110320075 (Prkcb)
   04727 GABAergic synapse
    110320075 (Prkcb)
   04725 Cholinergic synapse
    110320075 (Prkcb)
   04728 Dopaminergic synapse
    110320075 (Prkcb)
   04726 Serotonergic synapse
    110320075 (Prkcb)
   04720 Long-term potentiation
    110320075 (Prkcb)
   04730 Long-term depression
    110320075 (Prkcb)
   04723 Retrograde endocannabinoid signaling
    110320075 (Prkcb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110320075 (Prkcb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110320075 (Prkcb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320075 (Prkcb)
   05206 MicroRNAs in cancer
    110320075 (Prkcb)
   05205 Proteoglycans in cancer
    110320075 (Prkcb)
   05207 Chemical carcinogenesis - receptor activation
    110320075 (Prkcb)
   05231 Choline metabolism in cancer
    110320075 (Prkcb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110320075 (Prkcb)
   05214 Glioma
    110320075 (Prkcb)
   05223 Non-small cell lung cancer
    110320075 (Prkcb)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110320075 (Prkcb)
   05161 Hepatitis B
    110320075 (Prkcb)
   05171 Coronavirus disease - COVID-19
    110320075 (Prkcb)
   05164 Influenza A
    110320075 (Prkcb)
   05163 Human cytomegalovirus infection
    110320075 (Prkcb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110320075 (Prkcb)
   05140 Leishmaniasis
    110320075 (Prkcb)
   05143 African trypanosomiasis
    110320075 (Prkcb)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110320075 (Prkcb)
   05022 Pathways of neurodegeneration - multiple diseases
    110320075 (Prkcb)
  09165 Substance dependence
   05031 Amphetamine addiction
    110320075 (Prkcb)
   05032 Morphine addiction
    110320075 (Prkcb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110320075 (Prkcb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110320075 (Prkcb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110320075 (Prkcb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320075 (Prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110320075 (Prkcb)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110320075 (Prkcb)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110320075 (Prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 ABC1 APH
Other DBs
NCBI-GeneID: 110320075
NCBI-ProteinID: XP_021051624
Ensembl: MGP_PahariEiJ_G0013632
LinkDB
Position
1
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgtcaagtctgctgctttgttgtacacaagcgctgccatgag
ttcgtcacgttctcctgccccggtgcggacaagggcccggcctctgatgacccccggagc
aaacacaagtttaagatccacacctactccagccctaccttctgtgaccactgtggatca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgtatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgcggcactgaccacacggaacgccgtggc
cgcatctatatccaggcccacatcgacagggaggttctcatcgttgttgtaagagatgct
aaaaatctggtacctatggaccccaatggcttgtcagatccctacgtaaaactgaaactg
atccctgatcccaaaagtgagagcaagcagaagaccaagaccatcaagtgctccctcaac
ccagagtggaatgaaaccttcagatttcagctgaaggaatcagacaaagacagaagactg
tctgtagagatctgggattgggacctgaccagcaggaatgacttcatggggtctctgtcg
tttgggatttcagaactacagaaagccggtgtggatggctggttcaagttactaagccag
gaagagggcgagtacttcaatgtgcccgtgccgccagaaggaagcgagggcaacgaagag
ctgcggcagaagtttgagagagccaagattggccaaggtaccaaggctccagaagaaaag
acagctaacactatctccaaatttgacaacaatggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctgggaaaaggcagctttggcaaggtcatgctctctgag
cggaagggtacagatgagctctatgccgtgaagatcctgaagaaggatgtggtgatccaa
gatgatgatgtggagtgcaccatggtggagaagcgggtgctggccctgcctgggaagcct
ccgttcctgactcagctccattcctgcttccagaccatggaccgtctgtactttgtgatg
gagtatgtgaatgggggcgacctcatgtaccacatccaacaagttggccgtttcaaggag
ccccatgctgtattttacgctgcagagattgccatcggtctgttcttcttgcagagcaag
ggcattatttaccgtgacctgaaacttgacaacgtgatgctggattctgaggggcacatc
aaaatcgctgactttggcatgtgtaaggagaacatctgggatggggtgacaaccaagaca
ttctgtggcactccggactacattgccccagagatcattgcttatcagccctacgggaag
tctgtggactggtgggcatttggagtcctgctgtatgaaatgttggctggccaggcacct
tttgaaggggaggatgaggatgaactcttccagtcaatcatggaacacaatgtggcatat
cccaagtccatgtccaaggaagctgtggcaatctgcaaagggctaatgaccaaacaccca
ggcaagcgcctgggttgtgggcctgaaggggaacgagacattaaggagcatgcgtttttc
cggtatattgactgggagaaactcgaacgcaaggagattcagccaccttataaaccaaaa
gcttgtgggcgaaacgctgaaaacttcgaccggtttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgatcaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Mus pahari (shrew mouse): 110332714
Entry
110332714         CDS       T05929                                 

Gene name
Prkca
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05214  Glioma
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
mpah05231  Choline metabolism in cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110332714 (Prkca)
   04012 ErbB signaling pathway
    110332714 (Prkca)
   04014 Ras signaling pathway
    110332714 (Prkca)
   04015 Rap1 signaling pathway
    110332714 (Prkca)
   04310 Wnt signaling pathway
    110332714 (Prkca)
   04370 VEGF signaling pathway
    110332714 (Prkca)
   04066 HIF-1 signaling pathway
    110332714 (Prkca)
   04020 Calcium signaling pathway
    110332714 (Prkca)
   04070 Phosphatidylinositol signaling system
    110332714 (Prkca)
   04072 Phospholipase D signaling pathway
    110332714 (Prkca)
   04071 Sphingolipid signaling pathway
    110332714 (Prkca)
   04151 PI3K-Akt signaling pathway
    110332714 (Prkca)
   04150 mTOR signaling pathway
    110332714 (Prkca)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110332714 (Prkca)
   04540 Gap junction
    110332714 (Prkca)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110332714 (Prkca)
   04650 Natural killer cell mediated cytotoxicity
    110332714 (Prkca)
   04664 Fc epsilon RI signaling pathway
    110332714 (Prkca)
   04666 Fc gamma R-mediated phagocytosis
    110332714 (Prkca)
   04670 Leukocyte transendothelial migration
    110332714 (Prkca)
  09152 Endocrine system
   04911 Insulin secretion
    110332714 (Prkca)
   04929 GnRH secretion
    110332714 (Prkca)
   04912 GnRH signaling pathway
    110332714 (Prkca)
   04921 Oxytocin signaling pathway
    110332714 (Prkca)
   04926 Relaxin signaling pathway
    110332714 (Prkca)
   04935 Growth hormone synthesis, secretion and action
    110332714 (Prkca)
   04918 Thyroid hormone synthesis
    110332714 (Prkca)
   04919 Thyroid hormone signaling pathway
    110332714 (Prkca)
   04928 Parathyroid hormone synthesis, secretion and action
    110332714 (Prkca)
   04916 Melanogenesis
    110332714 (Prkca)
   04925 Aldosterone synthesis and secretion
    110332714 (Prkca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110332714 (Prkca)
   04270 Vascular smooth muscle contraction
    110332714 (Prkca)
  09154 Digestive system
   04970 Salivary secretion
    110332714 (Prkca)
   04971 Gastric acid secretion
    110332714 (Prkca)
   04972 Pancreatic secretion
    110332714 (Prkca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110332714 (Prkca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110332714 (Prkca)
  09156 Nervous system
   04724 Glutamatergic synapse
    110332714 (Prkca)
   04727 GABAergic synapse
    110332714 (Prkca)
   04725 Cholinergic synapse
    110332714 (Prkca)
   04728 Dopaminergic synapse
    110332714 (Prkca)
   04726 Serotonergic synapse
    110332714 (Prkca)
   04720 Long-term potentiation
    110332714 (Prkca)
   04730 Long-term depression
    110332714 (Prkca)
   04723 Retrograde endocannabinoid signaling
    110332714 (Prkca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110332714 (Prkca)
  09158 Development and regeneration
   04360 Axon guidance
    110332714 (Prkca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110332714 (Prkca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332714 (Prkca)
   05206 MicroRNAs in cancer
    110332714 (Prkca)
   05205 Proteoglycans in cancer
    110332714 (Prkca)
   05207 Chemical carcinogenesis - receptor activation
    110332714 (Prkca)
   05231 Choline metabolism in cancer
    110332714 (Prkca)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110332714 (Prkca)
   05214 Glioma
    110332714 (Prkca)
   05223 Non-small cell lung cancer
    110332714 (Prkca)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110332714 (Prkca)
   05161 Hepatitis B
    110332714 (Prkca)
   05171 Coronavirus disease - COVID-19
    110332714 (Prkca)
   05164 Influenza A
    110332714 (Prkca)
   05163 Human cytomegalovirus infection
    110332714 (Prkca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110332714 (Prkca)
   05143 African trypanosomiasis
    110332714 (Prkca)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110332714 (Prkca)
   05022 Pathways of neurodegeneration - multiple diseases
    110332714 (Prkca)
  09165 Substance dependence
   05031 Amphetamine addiction
    110332714 (Prkca)
   05032 Morphine addiction
    110332714 (Prkca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110332714 (Prkca)
   05415 Diabetic cardiomyopathy
    110332714 (Prkca)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110332714 (Prkca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110332714 (Prkca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110332714 (Prkca)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110332714 (Prkca)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110332714 (Prkca)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110332714 (Prkca)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    110332714 (Prkca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 ABC1 APH
Other DBs
NCBI-GeneID: 110332714
NCBI-ProteinID: XP_021069703
Ensembl: MGP_PahariEiJ_G0018471
LinkDB
Position
14
AA seq 672 aa
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgtttacccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaagaccacaaattcatc
gcccgcttcttcaagcaacccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
ttcgtcactttctcttgtccgggtgcggataagggacctgacactgacgaccccaggagc
aagcacaagttcaaaatccacacgtacggaagccctaccttctgcgatcactgtgggtcc
ctgctctacggacttatccaccaagggatgaaatgtgacacctgcgacatgaatgtccac
aagcagtgtgtgatcaatgtccctagcctctgcggaatggatcacacagagaagaggggg
cggatttatctgaaggccgaggtcaccgatgaaaagctccacgtcacggtacgagatgca
aaaaatctaatccctatggatccaaatgggctttcggatccttacgtgaagctgaaactt
attcctgaccccaagaatgagagcaaacagaaaaccaaaaccatccgctccacactgaac
cctcaatggaatgagtccttcacgttcaaattaaaaccttcagacaaagaccggcgactg
tctgtagaaatctgggactgggatcggacgactcggaatgacttcatgggctccctatcc
tttggtgtctcagagctgatgaagatgccggccagtggatggtacaagttgctcaaccaa
gaagagggcgaatactacaatgtgcccattccagaaggtgatgaagaaggcaacatggaa
ctcaggcagaagtttgagaaagccaagctaggccctgctggtaacaaagtcatcagccct
tcagaagacaggaagcaaccgtccaacaacctggacagagtgaaactcacggacttcaac
ttcctcatggtgctggggaaggggagctttgggaaggtgatgctggctgacaggaaggga
acagaggaactgtacgccatcaagatcctgaagaaggacgtggtgatccaggatgacgac
gtggagtgcaccatggtggagaagcgggtgctggccctgctcgacaagccgccgttcctg
acacagctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtc
aacggcggagacctcatgtaccacattcagcaagtcgggaaatttaaggagcctcaagca
gtattctacgcagccgagatctccatcggactgttcttccttcataaaagagggatcatt
tacagggatctgaagctggacaatgtcatgctggactcagaagggcacatcaaaattgcc
gacttcgggatgtgcaaggaacacatgatggatggagtcacaaccaggaccttctgtggg
actccagactacattgccccagagataatcgcttaccagccgtatgggaagtctgtggac
tggtgggcatatggcgtgctgctgtacgagatgctagccgggcagcctccgtttgatggt
gaagatgaagatgaactgtttcagtcaataatggagcacaatgtgtcctaccccaaatcc
ttgtccaaggaagctgtctccatctgcaaagggcttatgaccaaacaccctgccaagcgg
ctgggctgcgggcccgagggagagagggatgtcagggagcatgccttcttcaggaggatc
gactgggagaaactggagaacagggagatccaaccgcccttcaagcccaaagtgtgtggc
aaaggagcagaaaactttgacaagttcttcacgagagggcagcctgtcttaacaccacca
gatcagttggtcattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcacccgatcttacaaagtgcagtatga

KEGG   Mus pahari (shrew mouse): 110336366
Entry
110336366         CDS       T05929                                 

Gene name
Prkcg
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04150  mTOR signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05214  Glioma
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
mpah05231  Choline metabolism in cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110336366 (Prkcg)
   04012 ErbB signaling pathway
    110336366 (Prkcg)
   04014 Ras signaling pathway
    110336366 (Prkcg)
   04015 Rap1 signaling pathway
    110336366 (Prkcg)
   04310 Wnt signaling pathway
    110336366 (Prkcg)
   04370 VEGF signaling pathway
    110336366 (Prkcg)
   04066 HIF-1 signaling pathway
    110336366 (Prkcg)
   04020 Calcium signaling pathway
    110336366 (Prkcg)
   04070 Phosphatidylinositol signaling system
    110336366 (Prkcg)
   04071 Sphingolipid signaling pathway
    110336366 (Prkcg)
   04150 mTOR signaling pathway
    110336366 (Prkcg)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110336366 (Prkcg)
   04540 Gap junction
    110336366 (Prkcg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110336366 (Prkcg)
   04650 Natural killer cell mediated cytotoxicity
    110336366 (Prkcg)
   04666 Fc gamma R-mediated phagocytosis
    110336366 (Prkcg)
   04670 Leukocyte transendothelial migration
    110336366 (Prkcg)
  09152 Endocrine system
   04911 Insulin secretion
    110336366 (Prkcg)
   04929 GnRH secretion
    110336366 (Prkcg)
   04921 Oxytocin signaling pathway
    110336366 (Prkcg)
   04935 Growth hormone synthesis, secretion and action
    110336366 (Prkcg)
   04918 Thyroid hormone synthesis
    110336366 (Prkcg)
   04919 Thyroid hormone signaling pathway
    110336366 (Prkcg)
   04928 Parathyroid hormone synthesis, secretion and action
    110336366 (Prkcg)
   04916 Melanogenesis
    110336366 (Prkcg)
   04925 Aldosterone synthesis and secretion
    110336366 (Prkcg)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110336366 (Prkcg)
  09154 Digestive system
   04970 Salivary secretion
    110336366 (Prkcg)
   04971 Gastric acid secretion
    110336366 (Prkcg)
   04972 Pancreatic secretion
    110336366 (Prkcg)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110336366 (Prkcg)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110336366 (Prkcg)
  09156 Nervous system
   04724 Glutamatergic synapse
    110336366 (Prkcg)
   04727 GABAergic synapse
    110336366 (Prkcg)
   04725 Cholinergic synapse
    110336366 (Prkcg)
   04728 Dopaminergic synapse
    110336366 (Prkcg)
   04726 Serotonergic synapse
    110336366 (Prkcg)
   04720 Long-term potentiation
    110336366 (Prkcg)
   04730 Long-term depression
    110336366 (Prkcg)
   04723 Retrograde endocannabinoid signaling
    110336366 (Prkcg)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110336366 (Prkcg)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110336366 (Prkcg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336366 (Prkcg)
   05206 MicroRNAs in cancer
    110336366 (Prkcg)
   05205 Proteoglycans in cancer
    110336366 (Prkcg)
   05207 Chemical carcinogenesis - receptor activation
    110336366 (Prkcg)
   05231 Choline metabolism in cancer
    110336366 (Prkcg)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110336366 (Prkcg)
   05214 Glioma
    110336366 (Prkcg)
   05223 Non-small cell lung cancer
    110336366 (Prkcg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110336366 (Prkcg)
   05161 Hepatitis B
    110336366 (Prkcg)
   05171 Coronavirus disease - COVID-19
    110336366 (Prkcg)
   05163 Human cytomegalovirus infection
    110336366 (Prkcg)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110336366 (Prkcg)
   05143 African trypanosomiasis
    110336366 (Prkcg)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110336366 (Prkcg)
   05022 Pathways of neurodegeneration - multiple diseases
    110336366 (Prkcg)
  09165 Substance dependence
   05031 Amphetamine addiction
    110336366 (Prkcg)
   05032 Morphine addiction
    110336366 (Prkcg)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110336366 (Prkcg)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110336366 (Prkcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110336366 (Prkcg)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110336366 (Prkcg)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110336366 (Prkcg)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C ABC1 Kinase-like APH
Other DBs
NCBI-GeneID: 110336366
NCBI-ProteinID: XP_021074527
Ensembl: MGP_PahariEiJ_G0020956
LinkDB
Position
19
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPSSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcgggtctgggccctggcggaggcgactcagaggggggaccccgacccctgttttgc
agaaagggggcgctgaggcagaaggtggtccacgaggtgaagagccacaagttcaccgct
cgtttcttcaagcagccaaccttctgcagtcactgtaccgacttcatctggggcattgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcaccgccgatgccacgaattt
gtgaccttcgagtgtccaggcgctggaaagggcccccagacggatgaccctcgcaacaag
cacaagttccgactgcacagctacagcagtcccaccttctgcgaccactgtggttccctc
ctctacgggctggtgcaccagggcatgaaatgttcctgttgcgagatgaatgtgcaccgg
cgctgtgtgcgcagtgtgccctccctttgcggtgtggaccacacagagcgccgtggacgt
ctgcaactggaaatccgggctcctacgtcggatgagatccatattactgttggcgaggcc
cggaacctcattcctatggaccccaatggcctgtctgatccttacgtgaaactgaagctc
atcccggaccctcggaacctgacaaaacagaagacaaagactgtgaaagccaccctgaat
cccgtgtggaacgagaccttcgtgttcaacctgaagccaggggatgtggagcgccggctc
agtgtggaggtgtgggactgggacaggacatcccggaatgacttcatgggtgccatgtcc
tttggtgtctcagagctactcaaggcccccgtggatggatggtacaagttactgaaccag
gaggagggcgaatattacaatgtaccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaattaccccttggaattgtatgagagagtgcggatgggcccctct
tcctcccccatcccttctccatcccccagtcctacggactccaagcgatgcttctttggt
gccagcccaggacgcctgcatatctctgacttcagcttcctcatggttctagggaaaggc
agttttgggaaggtaatgctggcagagcgcagaggctccgatgaactctacgccatcaag
atactgaagaaagatgtcatcgtccaggatgacgatgtagactgcaccctcgtagagaag
cgtgtgctggcattgggaggccgaggtcctggaggccggccacactttctcacgcagctt
cactccacctttcagactccggaccgcctgtattttgtgatggagtacgtcactgggggc
gatttaatgtaccacattcagcagttgggcaagtttaaggagccccacgcagcattctat
gctgcggaaatcgccataggcctcttcttccttcacaaccagggcatcatctacagggac
ctcaagttggataatgtgatgctggatgctgaaggacacatcaagatcacagactttggc
atgtgtaaagagaatgtcttccctgggtccacaacccgcaccttctgtggcaccccagac
tacatagcacctgagatcattgcctatcagccctacgggaagtctgtcgactggtggtct
tttggggtcctgctgtatgagatgttggcaggacagccaccctttgatggggaagacgag
gaggagttgtttcaagccatcatggaacaaactgtcacctatcccaagtccctttcccgg
gaagctgtggccatctgcaaagggttcctgaccaagcacccaggaaaacgcctgggctca
gggccagatggggaacccaccatccgggctcacggctttttccgttggatcgattgggag
aggttggagagactggaaattgcgcctcctttcagaccacgtccgtgtggccgcagtggc
gaaaactttgacaagttcttcacgcgggcagcgccagcattgaccccgccagaccgcttg
gtcctagccagcatcgaccaagctgatttccagggctttacttatgtgaacccggacttc
gtgcacccagatgcccgcagcccctcaagccctgtgcccgtgcctgtcatgtaa

DBGET integrated database retrieval system