KEGG   Mus pahari (shrew mouse): 110320605
Entry
110320605         CDS       T05929                                 
Symbol
Fgg
Name
(RefSeq) fibrinogen gamma chain isoform X1
  KO
K03905  fibrinogen gamma chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110320605 (Fgg)
   04611 Platelet activation
    110320605 (Fgg)
   04613 Neutrophil extracellular trap formation
    110320605 (Fgg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110320605 (Fgg)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110320605 (Fgg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320605 (Fgg)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320605 (Fgg)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110320605 (Fgg)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110320605 (Fgg)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110320605 (Fgg)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Spc29
Other DBs
NCBI-GeneID: 110320605
NCBI-ProteinID: XP_021052355
Ensembl: MGP_PahariEiJ_G0026546
LinkDB
Position
4:73735316..73742976
AA seq 443 aa
MSWSLQPQSFVLCCMLLLFSPTGLAYVATRDNCCILDERFGSFCPTTCGIADFLSSYQTD
VDNDLRTLEDILLRAENRTTEAKELIKAIQIYYNPDQPPKPGMIDSATQKSKKMVEEIVK
YEALLLTHESSIRYLQEIYNSNHQKITNLKQKVAQLEAQCQEPCKDSVQIHDTTGKDCQE
IANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKKNWIQYKEGF
GHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVAPESDKYR
LTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWW
MNKCHAGHLNGNYYPGGTYSKSSTTNGYDNGIIWATWKTRWYSMKETTMKIIPFNRISIG
EGQQHHMGGSKQVSVDHEVEIEY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagttggtctttgcagccccagagtttcgttctttgctgcatgctgttactgttctct
ccaacgggcctggcatatgttgctaccagagataactgttgcatcctagatgagagattc
ggtagtttctgcccaaccacctgtggcatcgcagacttcctgtcttcctaccaaactgac
gtggacaatgatctccgaacgctggaagacatcttactccgagctgaaaacagaaccaca
gaagccaaagaactgatcaaagcaatccaaatttactacaacccagaccaacccccaaag
ccaggtatgatagacagtgccactcagaagtctaagaagatggtagaagaaattgtgaaa
tacgaagcgctgctgttaacccatgagtcaagcatccggtatttacaggaaatctataat
tcaaaccaccagaagattacgaacctgaaacagaaggtagcccagcttgaagcccagtgc
caggagccttgcaaggactccgtgcaaatccatgacacaactggaaaagattgtcaggaa
attgccaacaagggcgccaaagaaagtggactttacttcattcggcctttgaaagctaag
cagcagttcttagtgtactgtgaaatcgatggatctggaaatggttggaccgtattgcag
aagagacttgatggcagcgtggatttcaagaagaactggattcagtataaagaaggattt
ggacacctgtcgcctactggcaccacagagttttggctgggaaatgagaagattcatttg
ataagcatgcagtccacaatcccatatgcactgagaatacagctcaaagactggaatgga
agaaccagcactgcggactatgccatgttcagggtggctcccgagtctgacaaataccgc
ctgacctacgcctacttcattggtggggacgctggggatgccttcgacggctacgatttt
ggcgatgaccccagtgacaagtttttcacatcccacaacggcatgcagttcagtacctgg
gacaacgacaacgataagtttgaaggcaactgtgcggaacaggatggatctggctggtgg
atgaacaaatgtcatgccggccacctcaatggaaattattacccaggtggtacttactca
aagtcatctactactaacggttatgacaacggcattatttgggcaacctggaaaacccgc
tggtattccatgaaggaaaccaccatgaagataattcccttcaacagaatctccatcgga
gaaggacagcaacatcacatggggggatccaaacaggtcagcgtggatcatgaagttgaa
attgaatactga

KEGG   Mus pahari (shrew mouse): 110320684
Entry
110320684         CDS       T05929                                 
Symbol
Fgb
Name
(RefSeq) fibrinogen beta chain isoform X1
  KO
K03904  fibrinogen beta chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110320684 (Fgb)
   04611 Platelet activation
    110320684 (Fgb)
   04613 Neutrophil extracellular trap formation
    110320684 (Fgb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110320684 (Fgb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320684 (Fgb)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320684 (Fgb)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110320684 (Fgb)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110320684 (Fgb)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110320684 (Fgb)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha CALCOCO1 FANCI_S2
Other DBs
NCBI-GeneID: 110320684
NCBI-ProteinID: XP_021052464
Ensembl: MGP_PahariEiJ_G0026548
LinkDB
Position
4:complement(73771806..73779555)
AA seq 480 aa
MKHLWMLLLLCVFSVHTQAANDDYDEPTDSVDARGHRPVDRRKEEPPSLRPAPPPISGGG
YRARPAKATANQKKERIPPNAGGCLHADTDMGVLCPTGCTLQQTLINQERPIKSSVAELN
NNIQSVSQTSSVTFQYLTLLKDMWKKKQAQVKENENVINEYSSILEDQRLYIDETVNDNI
PLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVNCNIPVVSGKECEEIIRKGGET
SEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNED
TKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEASKYQVS
VNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGG
WWYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaagcatctatggatgctgctgctgttgtgtgttttctcagttcatactcaagctgcc
aatgatgactacgatgaaccgacggatagcgtggatgcccgtggtcatcgacctgttgac
aggagaaaggaagagcctcctagcctaagacctgcccctcctcctatcagcggaggaggc
tatcgagcccgtccagccaaggctactgccaaccagaagaaagaacggataccccccaat
gcaggaggctgtcttcacgctgacacagacatgggagtgctgtgtcctacgggatgtaca
ttgcaacaaactttgataaaccaggaaaggccaatcaagagcagtgttgctgagttaaat
aacaacatacagtctgtttcccagacctcctcagtcacctttcagtacctgactctgcta
aaggacatgtggaaaaagaagcaagcacaagttaaagagaatgaaaatgtcataaatgag
tattcctccatcctggaagaccagagattatatattgatgagactgtgaacgataatatc
ccccttaatcttcgtgtgctccgctcaatcctggaggacctaagaagcaaaatacaaaaa
ttagagtctgacatctcagctcaaatggaatattgccgcactccatgcaccgtcaactgt
aacatcccagtggtgtctgggaaagaatgtgaggagatcattaggaagggaggtgagaca
tccgaaatgtatcttatccagcctgacacctccatcaagccatatagagtatactgcgac
atgaaaacagaaaacggaggatggacagtcatacagaaccgtcaggatggcagcgtcgac
tttggcaggaaatgggacccatacaaaaaaggattcggaaatattgccaccaatgaagac
acaaagaagtactgtggcttgccaggcgaatactggcttggcaatgataagattagccag
ctcaccaggatgggacccacagaacttctcatcgaaatggaggactggaaaggagacaag
gtgaaggcacattatggaggcttcacggtgcagaacgaggccagcaagtatcaagtctcc
gtgaacaagtacaaagggaccgcaggcaacgccctcatggatggggcctctcagctggtg
ggggagaacagaaccatgaccatccacaacggcatgttcttcagcacatatgacagggac
aacgacggctgggtaactacggatccaagaaaacagtgctccaaagaagatggtggtggc
tggtggtataacagatgccacgcggccaatccgaatggcagatactactggggtggcctt
tacagctgggacatgtccaagcacggcacagatgatggtgtggtgtggatgaactggaag
ggatcgtggtactcaatgaggaagatgtctatgaagatcaggcccttcttcccacagcaa
tag

KEGG   Mus pahari (shrew mouse): 110321050
Entry
110321050         CDS       T05929                                 
Symbol
Fga
Name
(RefSeq) fibrinogen alpha chain isoform X1
  KO
K03903  fibrinogen alpha chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110321050 (Fga)
   04611 Platelet activation
    110321050 (Fga)
   04613 Neutrophil extracellular trap formation
    110321050 (Fga)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110321050 (Fga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110321050 (Fga)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110321050 (Fga)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110321050 (Fga)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110321050 (Fga)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110321050 (Fga)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Fibrinogen_aC Perilipin
Other DBs
NCBI-GeneID: 110321050
NCBI-ProteinID: XP_021052802
Ensembl: MGP_PahariEiJ_G0026547
LinkDB
Position
4:73754828..73762233
AA seq 784 aa
MLSLRVVCLVLGVASTVWVCAAEDKGEFLSEGGGVRGPRVVERHQSQCKESDWPFCSDED
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQKNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTFGQVSEDLRRRIEILKRKVIEKAQQIQVLQSNVRAQLIDMKRLEVDIDIKIRS
CKGSCSRAVNRETNLQDYEGQQKQLEQVIAKELLPTKDRQYLPAIKMFPVPDFVPGSFKS
QLQEAPPEWKALTEMRQMRMELERPGKDGGSRGDSRGDSRGDYATRGPGSKAENPTNPGP
GGSGSWRPGNSGTGSDGNRYPGTTGSDGTGDWGTGSSRPGSDSGNFRPANPNWGEFSEFG
ESSSPATRKEYHSGKTVTSKGDKELLIGNEKVTSSGTSTTHRSCSKTITKTVQGADGRRE
VVKEVVTSDDGSDCGDAIELDMTHHGFGGRLDELSERHPDLSGFFDGHFGLISPNFKEFG
SKTHSDSDIFSNIENPHGSEFSSSSKTSTVKKQVTKSYKMADEAGSEAHQEEETRTTKRG
RARARTMRDCDDVLQTQTSGAPNGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQRMDGS
LNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTMRGSVLRVELEDWTGKEAYAEYHF
RVGSETEGYSLQVSSYRGTAGDALVEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEV
YGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP
LVGR
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgctgtccctgagggtcgtctgccttgtcttgggcgtggccagcacagtctgggtatgt
gctgcggaagataaaggtgaattcttgtcagaaggaggaggagtgcgtggcccaagagtt
gtggagagacatcaaagtcaatgcaaggagtcagactggcctttctgctctgatgaggac
tggaaccacaaatgcccttctggctgcaggatgaaagggttgattgatgaagccaatcag
gattttaccaacagaatcaacaagctcaaaaactcactatttgactttcaaaagaacaac
aaggattctaactcactgaccaggaatatcatggagtatttgagaggggacttcgcgaat
gccaacaactttgataacactttcgggcaagtgtcagaagacctgaggcgcagaattgag
atcctgaagcgaaaagtcatagagaaagcacaacagattcaagttctgcagagcaatgtc
agggctcagttgatagacatgaagcgcctggaggtggacattgatatcaagatccgctct
tgcaaagggtcctgcagcagggctgtaaaccgtgagacaaatctacaggactatgaaggt
cagcaaaagcagcttgaacaggtcatcgctaaagaattgcttcctacaaaagacaggcag
tacttgccagcaataaaaatgtttccagttcccgacttcgttcccggaagttttaagagc
cagcttcaggaggcccctccagagtggaaggcattaacagaaatgcggcagatgagaatg
gagctggagaggcccgggaaggatgggggttcgcgaggagactcgcgcggagattctcga
ggggactatgcaacacgtggaccagggtcaaaggcagaaaaccccacgaaccctggacct
ggtggatctgggtcttggcgtcctgggaactcagggactggaagtgatggaaatcggtac
cctgggaccacggggtctgatggcactggagactggggtaccggaagctctagacctggc
tcggactctgggaactttaggcccgccaaccctaactggggtgagttttcggagtttgga
gagagtagcagcccagcgacaagaaaagagtatcactcaggtaaaacggtcacttctaaa
ggagataaagagctcctgattggaaatgagaaagtcacctcttctggcacaagcaccaca
catcgttcatgctctaaaaccattaccaagactgtccaaggtgctgatggtcgccgagaa
gtggtcaaagaagtggtcacctcggatgatggttcagactgtggtgatgccatcgagtta
gacatgacccaccacggttttggtggcaggctcgacgaactctctgaaagacatcccgac
ctttctgggttttttgacggtcactttggtttaatctcacctaacttcaaagaatttggc
agtaagacccactctgattccgacatcttctcaaacattgagaacccccatggatctgag
ttttcttccagtagcaaaacctcaactgtcaaaaaacaagtaaccaagtcctataaaatg
gcagatgaggcaggaagcgaagctcaccaggaagaagaaactcggaccactaagaggggc
cgtgccagagctcgcacaatgagagactgtgatgatgtcctccaaacacaaacttcaggt
gccccaaatggcattttcagtatcaagccacctggatccagtaaggttttttctgtttat
tgcgatcaagagaccagtctgggaggatggcttttgatccagcaaagaatggatggatca
ctgaattttaaccggacctggcaagactacaagagaggtttcggcagcctgaatgacaaa
ggggaaggagaattctggctaggcaatgactacctccacttactcactatgaggggctcg
gtcctcagggttgaattagaggactggaccggaaaagaggcttatgcggagtaccacttc
cgggtaggctctgagactgagggctactcgctgcaggtctcctcctaccggggcactgct
ggagatgctctggtggagggctcggtggaggaggggacagaatacacctcacacagcaac
atgcagttcagtacctttgacagagatgccgaccaatgggaagagaactgtgcagaggtc
tatgggggaggctggtggtacaacagctgtcaggccgccaatctcaatggcatttactac
cccgggggcacctacgaccccaggaacaacagcccctacgagatagaaaacggggtggtc
tgggttcccttcagaggagcagattattccctcagggctgttcggatgaaaatcagacca
ctggtggggcggtag

DBGET integrated database retrieval system