KEGG   Mus pahari (shrew mouse): 110320616
Entry
110320616         CDS       T05929                                 
Symbol
Vtcn1
Name
(RefSeq) V-set domain-containing T-cell activation inhibitor 1
  KO
K06747  immune costimulatory protein B7-H4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110320616 (Vtcn1)
SSDB
Motif
Pfam: Ig_3 V-set I-set Ig_2 ig Ig_6 Peptidase_S78_2
Other DBs
NCBI-GeneID: 110320616
NCBI-ProteinID: XP_021052373
Ensembl: MGP_PahariEiJ_G0026869
LinkDB
Position
4:90631608..90700121
AA seq 283 aa
MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEP
DIKLNGIVIQWLKEGIEGLVHEFKEGKDDLSRQHEMFRGRTAVFADQVVVGNASLRLKNV
QLMDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVA
WASQVDQGANFSEISNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TDSEVKRRSQLQLLNSGPSPCVPSSAFAAGWALLSLSYCLMLR
NT seq 852 nt   +upstreamnt  +downstreamnt
atggcttccttggggcagatcatcttttggagtattattaacatcatcatcatcctggct
ggggccatcgcactcatcattggctttggcatttcaggcaagcacttcatcacggtcacg
accttcacctcagctggaaacattggagaggacgggaccctgagctgcacttttgaacca
gacatcaaactcaacggcatcgtcatccagtggctgaaagaaggcatcgaaggtttggtc
cacgagttcaaagaaggcaaagacgacctctcacgacagcatgagatgttcagaggccgc
acagcagtgtttgccgatcaggtggtggttggcaatgcttccctgagactgaagaacgtg
cagctcatggatgctggcacctacacgtgttatatccgcacctcgaaaggcaaggggaat
gcaaaccttgagtataagactggagccttcagtatgccagagataaatgtggactataat
gccagttcagaaagtttacgctgcgaggctcctcggtggttcccccagcccactgtggcc
tgggcatctcaagttgaccaaggagccaacttctcagaaatctccaacaccagctttgag
ttgaactctgagaatgtgaccatgaaggtcgtatctgtgctctacaatgtcacaatcaac
aacacatactcctgtatgatcgaaaacgacattgccaaagccaccggggacatcaaagtg
acagattcagaggtcaaaaggcggagtcagctgcagctgctgaactccgggccttccccg
tgtgttccttcttctgcctttgcggctggctgggcactcctatctctctcctattgcctg
atgctaagatga

DBGET integrated database retrieval system