KEGG   Mus pahari (shrew mouse): 110320634
Entry
110320634         CDS       T05929                                 
Symbol
Cfi
Name
(RefSeq) complement factor I isoform X1
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110320634 (Cfi)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110320634 (Cfi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110320634 (Cfi)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320634 (Cfi)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     110320634 (Cfi)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110320634 (Cfi)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110320634 (Cfi)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR Trypsin_2 Kazal_2
Other DBs
NCBI-GeneID: 110320634
NCBI-ProteinID: XP_021052391
Ensembl: MGP_PahariEiJ_G0027077
LinkDB
Position
4:117872100..117910651
AA seq 603 aa
MKCVHLILLLLAFHLSSSRSTSASDLPQEELVDQKCLLQKYTHRSCDKVFCQPWQRCISG
TCICKLPYQCPKAGTPVCATDGRKYPTYCHQKSFECLHPEVKFSNNGTCTGEGKFNVSLI
YGLTEREGIVQVKLVDHDEKMFICKNSWSTAEANVACVDLGFPLGVRDIQGRFNISGNLH
INDTECLHVRCRGIETSLAECAFTRRRTETPYDLASVVCYKQDADFPTSQSFQCVNGKYI
PQEKACNGVNDCGDQSDELCCKGCRDNAFICKSGVCIPDQYKCNGEVDCITGEDESRCEE
GRQQSIQKGLARADQGKTEIEIEKIEMLTPSMDTERKRIKSLLPKLSCGVRRNTHTRRKR
VIGGKPAKVGDYPWQVAIKDGERITCGGIYIGGCWILTAAHCVRPSRAHSYQIWSALLDW
LKPNSELTIQTVKRVIVHENYNGATFQNDIALVEMKMHTGKKECQLSNSVPACVPWSPFL
FQPNDRCIISGWGREKDNQRVYSLRWGQVDLIGNCSQFYPDRYYEKEMQCAGTSDGSIDA
CKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPGFPGVYTRVANYFDWISNHVGRSLVSQ
HNV
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgaagtgtgttcatctcattctgcttctcttggctttccacttgagttcttccaggtcc
acgtcagcatcagatctgcctcaggaggagctggtagatcagaaatgcttactgcagaaa
tacacgcatcgctcctgtgacaaggtcttctgccagccgtggcagagatgtatctccggg
acctgtatctgcaaactcccctaccagtgcccgaaggctggcaccccagtgtgcgccaca
gatggaagaaagtacccgacatactgtcaccagaagagtttcgaatgtcttcacccagag
gtcaagttttcaaataatggaacgtgcacaggtgaaggaaagtttaatgtttccttgatt
tatggactcacagaaagagagggaattgttcaagtcaaacttgtggaccatgatgagaaa
atgttcatatgtaaaaacagctggagcacggcggaggccaacgtggcctgcgtcgacctt
ggatttccactgggtgttcgtgacatacaaggaaggtttaatatatctggaaatctccat
ataaatgacactgaatgcctgcatgtacgttgccggggaatagagaccagtttggccgag
tgtgcctttaccaggaggagaactgagacgccctatgacttggcgagtgtagtgtgttac
aagcaggatgcagatttcccaacgagtcagtccttccaatgtgtgaatgggaagtacatt
cctcaggagaaagcctgcaacggtgtcaatgactgtggagaccaaagtgatgagctatgt
tgcaaaggttgccgggataacgctttcatttgtaagtcgggagtttgcattccagaccaa
tataagtgtaatggtgaggtggactgcatcactggtgaagacgagagtcgttgtgaagaa
ggcagacagcagagcattcaaaaaggccttgcacgggcagatcaaggaaaaactgaaatt
gaaattgaaaaaatagaaatgttgactcctagtatggacacagaaagaaaaaggataaag
tccttattacctaaactctcctgtggagtcagaagaaacactcacactcgcaggaaacga
gtgattggagggaagccagcgaaagtgggagactacccctggcaggtggcaattaaggat
ggcgaaagaatcacctgtggtggcatttatatcggtggctgctggattctgactgctgca
cactgtgttagacccagtagagctcacagttaccaaatctggtcggctttattagactgg
ctaaaacctaattctgagttgacaattcaaacagtgaagagagttattgtccacgaaaac
tataatggagccaccttccaaaacgacatagctttggttgaaatgaaaatgcacacgggc
aagaaagaatgtcaactctccaattctgtccctgcctgtgtcccgtggtctccatttctg
ttccagccgaatgacagatgcatcatctctggatggggtcgagagaaagataaccaaaga
gtctactcactccgatggggccaagtcgatctaataggaaactgctcccagttctaccca
gatcgctactatgagaaagagatgcagtgcgcaggtaccagtgatgggtccattgatgcc
tgcaaaggagactccggaggccccttggtctgtgaggatatcaacaatgtcacttacgtt
tggggcattgtgagctggggagaaaattgtgggaagcccggtttcccaggtgtttacacc
agagtggccaattattttgattggattagcaatcacgttggaaggtcccttgtttctcaa
cacaatgtctga

DBGET integrated database retrieval system