KEGG   Mus pahari (shrew mouse): 110320782
Entry
110320782         CDS       T05929                                 
Symbol
Gna14
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-14
  KO
K04636  guanine nucleotide-binding protein subunit alpha-14
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah05142  Chagas disease
mpah05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110320782 (Gna14)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110320782 (Gna14)
   05142 Chagas disease
    110320782 (Gna14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110320782 (Gna14)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110320782 (Gna14)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Atx10homo_assoc AAA_24 AAA_29
Other DBs
NCBI-GeneID: 110320782
NCBI-ProteinID: XP_021052579
Ensembl: MGP_PahariEiJ_G0014291
LinkDB
Position
1:128445758..128611764
AA seq 355 aa
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVSAL
SRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccggctgctgctgtttgtctgcggaggaaaaagagtctcagcgcatcagcgcggag
atcgagcggcagcttcgtcgcgacaagaaggacgcgcgccgcgagctcaagctgctcttg
ctgggaaccggtgagagtgggaaaagcacctttatcaagcagatgaggataatccatggg
tctggctacagtgatgaagatagaaagggcttcacgaagctggtttaccaaaacatattc
acggccatgcaagccatgatcagagcaatggataccctgaggatacaatacatgtgtgag
cagaataaggaaaatgcccagatcatcagggaagtggaagtagacaaagtctctgcactc
tccagggaccaggtggcagccatcaagcagctgtggctggatcccggaatccaggagtgt
tacgacaggaggagggagtaccagctgtcagactctgccaaatattatctgacggacatt
gaccgaatcgccatgccctctttcgtgccaacacaacaggatgtgcttcgtgttcgagtg
cccaccactggcatcatagaatatccatttgatttggaaaacatcatcttccggatggtg
gatgttggtggccagcgatctgaacgacggaaatggattcactgctttgagagtgtcacc
tccatcattttcttggttgctctgagtgaatatgaccaggttctggctgagtgtgacaat
gagaaccgtatggaggagagcaaagccctgtttaaaaccatcatcacctatccctggttt
ctgaactcctctgtgattctgttcttaaataagaaggatcttctggaagagaaaatcatg
tactctcatctaattagctacttcccagagtacacaggaccaaagcaagatgtcaaagct
gccagggactttatcctgaagctgtatcaagaccagaatcctgacaaagagaaagtcatc
tattctcacttcacatgtgctacagacaccgagaatatccgctttgtgtttgctgctgtc
aaagacacaatcctacagctaaacctacgggagttcaacttggtgtaa

KEGG   Mus pahari (shrew mouse): 110326239
Entry
110326239         CDS       T05929                                 
Symbol
Gna11
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04540  Gap junction
mpah04725  Cholinergic synapse
mpah04730  Long-term depression
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110326239 (Gna11)
   04022 cGMP-PKG signaling pathway
    110326239 (Gna11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110326239 (Gna11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110326239 (Gna11)
   04929 GnRH secretion
    110326239 (Gna11)
   04912 GnRH signaling pathway
    110326239 (Gna11)
   04935 Growth hormone synthesis, secretion and action
    110326239 (Gna11)
   04928 Parathyroid hormone synthesis, secretion and action
    110326239 (Gna11)
   04925 Aldosterone synthesis and secretion
    110326239 (Gna11)
   04927 Cortisol synthesis and secretion
    110326239 (Gna11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110326239 (Gna11)
  09156 Nervous system
   04725 Cholinergic synapse
    110326239 (Gna11)
   04730 Long-term depression
    110326239 (Gna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326239 (Gna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110326239 (Gna11)
   05163 Human cytomegalovirus infection
    110326239 (Gna11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110326239 (Gna11)
   05142 Chagas disease
    110326239 (Gna11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110326239 (Gna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110326239 (Gna11)
   04031 GTP-binding proteins [BR:mpah04031]
    110326239 (Gna11)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110326239 (Gna11)
  Exosomal proteins of melanoma cells
   110326239 (Gna11)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110326239 (Gna11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 110326239
NCBI-ProteinID: XP_021060133
Ensembl: MGP_PahariEiJ_G0031060
LinkDB
Position
9:complement(46063133..46077670)
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgacgaggtgaaggagtcgaagcgc
atcaacgcggagatcgagaaacagctgcggcgggacaagcgcgacgcccggcgcgagctt
aagctgctgctacttggcactggcgagagcgggaagagtaccttcatcaagcagatgcgc
atcatccatggggccggctactcggaggaggacaagcgcggcttcaccaagctggtgtac
cagaacatcttcaccgccatgcaggccatggtgcgcgccatggagacgctcaagatcctc
tacaagtatgagcagaacaaggccaatgcactcctgatccgggaggttgatgtggagaag
gtcacgacttttgagcaccagtatgtgaatgccatcaagacattgtggagtgaccctggt
gtccaggagtgttatgatcgcaggcgggagttccagctgtctgactcggctaagtactac
ttgacagacgtggaccgcatcgccacagtaggctacctgcccacccagcaggatgtgctg
cgggtacgcgtgcccaccactggcatcatcgagtacccgtttgacctggagaacatcatc
ttcaggatggtggatgtgggcgggcagaggtcagagcgcaggaagtggatccattgcttt
gagaacgtgacttccatcatgttcttggtggcactaagcgagtatgaccaagtcctagtg
gagtcagataatgagaaccgcatggaggagagcaaggccctgttccgcacaatcatcacc
tacccctggttccagaactcgtctgtcattctcttcctcaacaagaaggaccttctagaa
gacaagatcctgcactcacacttggtcgattacttccctgagttcgatgggccacagagg
gatgcacaggccgcacgcgagttcattctgaagatgtttgtggacctgaaccctgacagc
gacaagatcatctactcccacttcacatgcgccactgacaccgagaacatccgctttgtg
ttcgcagctgtgaaggacaccatcttgcagctgaacctgaaggagtacaacctggtgtga

KEGG   Mus pahari (shrew mouse): 110326812
Entry
110326812         CDS       T05929                                 
Symbol
Gna15
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-15
  KO
K04637  guanine nucleotide-binding protein subunit alpha-15
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04926  Relaxin signaling pathway
mpah05142  Chagas disease
mpah05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110326812 (Gna15)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110326812 (Gna15)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110326812 (Gna15)
   05142 Chagas disease
    110326812 (Gna15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110326812 (Gna15)
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110326812 (Gna15)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 Rad17 AAA_24
Other DBs
NCBI-GeneID: 110326812
NCBI-ProteinID: XP_021061071
Ensembl: MGP_PahariEiJ_G0031059
LinkDB
Position
9:complement(46035558..46057045)
AA seq 374 aa
MARSLTWGCCPWCLTEEEKSAARIDQKINRILLEQKKQEREELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEDRRAFRLLIFQNIFVSMQAMIDAMDRLQIPFSRPDSKQHASLVMTQD
PYKVSSFEKPYALAMQYLWRDAGIRACYERRREFHLLDSAVYYLSHLERISEDSYIPTAQ
DVLRSRMPTTGINEYCFSVKKTKLRIVDVGGQKSERRKWIHCFENVIALIYLASLSEYDQ
CLEENDQENRMEESLALFNTILELPWFKSTSVILFLNKTDILEDKIHTSHLATYFPSFQG
PRRDAEAAKSYILDMYARVYASCAEPQDGGRKGSRARRFFAHFTCATDTQSIRSVFKDVR
DSVLARYLDEINLL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcccggtccctgacttggggctgctgtccctggtgcctgacggaggaggagaagtct
gccgccagaatcgatcagaagatcaacaggattttgttggaacagaaaaaacaagagcgc
gaggaattgaaactcctgctgttggggcccggtgagagcgggaaaagcacgttcatcaag
caaatgcgcatcatccacggtgcgggctactctgaggaggaccgcagagccttccggctg
ctcatcttccagaacatcttcgtctccatgcaggccatgatcgatgcgatggaccggctg
cagatccccttcagcaggcctgacagcaagcagcacgccagcctagtgatgacccaggac
ccctataaagtgagctcatttgagaagccgtatgcactggccatgcagtacctgtggcgg
gacgcgggcatccgtgcatgctacgagcgcaggcgtgaattccacctgctggactccgcg
gtgtattacctgtcacacctggagcgcatatcagaggacagctacatccccactgcgcaa
gatgtgctgcgcagtcgcatgcccaccacaggcatcaatgagtactgcttctccgtgaag
aaaaccaaactgcgcatcgtggatgttggtggccagaagtcggaacgaaggaaatggatc
cactgtttcgagaacgtgattgccctcatctacctggcctccctgagcgagtatgaccag
tgcctagaggagaatgatcaggagaatcgcatggaggagagcctcgctctgttcaacacg
atcctagagctgccctggttcaagagcacctcggtcatcctctttctaaacaagacggac
atcttggaggataagatccacacctcccacctggccacatacttccccagtttccaggga
ccccggcgcgacgcagaggccgccaagagctacatcttggacatgtacgcgcgggtgtac
gcgagctgcgcagagccccaggacggtggcaggaaaggctcccgcgcgcgccgcttcttc
gcacacttcacctgtgccacggacacacaaagcatccgcagcgtgttcaaggacgtgcgg
gactcggtgctggcccggtacttggatgagatcaacctgctatga

KEGG   Mus pahari (shrew mouse): 110336980
Entry
110336980         CDS       T05929                                 
Name
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04728  Dopaminergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah05010  Alzheimer disease
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110336980
   04371 Apelin signaling pathway
    110336980
   04020 Calcium signaling pathway
    110336980
   04071 Sphingolipid signaling pathway
    110336980
   04022 cGMP-PKG signaling pathway
    110336980
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110336980
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110336980
   04062 Chemokine signaling pathway
    110336980
  09152 Endocrine system
   04911 Insulin secretion
    110336980
   04922 Glucagon signaling pathway
    110336980
   04929 GnRH secretion
    110336980
   04912 GnRH signaling pathway
    110336980
   04915 Estrogen signaling pathway
    110336980
   04921 Oxytocin signaling pathway
    110336980
   04935 Growth hormone synthesis, secretion and action
    110336980
   04918 Thyroid hormone synthesis
    110336980
   04928 Parathyroid hormone synthesis, secretion and action
    110336980
   04916 Melanogenesis
    110336980
   04924 Renin secretion
    110336980
   04925 Aldosterone synthesis and secretion
    110336980
   04927 Cortisol synthesis and secretion
    110336980
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110336980
   04270 Vascular smooth muscle contraction
    110336980
  09154 Digestive system
   04970 Salivary secretion
    110336980
   04971 Gastric acid secretion
    110336980
   04972 Pancreatic secretion
    110336980
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110336980
  09156 Nervous system
   04724 Glutamatergic synapse
    110336980
   04725 Cholinergic synapse
    110336980
   04728 Dopaminergic synapse
    110336980
   04726 Serotonergic synapse
    110336980
   04720 Long-term potentiation
    110336980
   04730 Long-term depression
    110336980
   04723 Retrograde endocannabinoid signaling
    110336980
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110336980
  09159 Environmental adaptation
   04713 Circadian entrainment
    110336980
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336980
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110336980
   05163 Human cytomegalovirus infection
    110336980
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110336980
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110336980
   05142 Chagas disease
    110336980
   05143 African trypanosomiasis
    110336980
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110336980
   05016 Huntington disease
    110336980
   05017 Spinocerebellar ataxia
    110336980
   05022 Pathways of neurodegeneration - multiple diseases
    110336980
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110336980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110336980
   04031 GTP-binding proteins [BR:mpah04031]
    110336980
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110336980
GTP-binding proteins [BR:mpah04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    110336980
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 110336980
NCBI-ProteinID: XP_021075415
Ensembl: MGP_PahariEiJ_G0014290
LinkDB
Position
1:128153276..128395096
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagccaggagg
atcaacgacgagatcgagcggcagctgcgcagggacaagcgcgacgcccgccgggagctc
aagctgctgctgctggggacaggggagagtggcaagagcaccttcatcaagcagatgagg
atcatccatgggtcgggatactctgacgaagacaagaggggcttcaccaaactggtgtat
cagaacatcttcacagccatgcaggccatgatcagagctatggacactctcaagatccca
tacaagtatgaacacaataaggctcatgcacagttggttcgagaggttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagcttgtggaatgatcctgga
atccaggagtgctacgatagacgacgggaatatcagttatctgactctaccaaatactat
ctgaatgacttggaccgtgtagccgacccttcctatctgcctacacaacaagacgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtaggaggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctccatcatgtttctagtagcgcttagcgaatatgatcaagttcttgtg
gagtcagacaatgagaaccgtatggaggagagcaaagccctgtttagaacaattatcacc
tacccctggttccagaactcctctgtgattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccacctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaatcctgacagt
gacaaaatcatctactcccacttcacgtgcgccacagatactgagaacatccgcttcgtc
tttgctgccgtcaaggacaccatcctgcagctgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system