KEGG   Mus pahari (shrew mouse): 110320932
Entry
110320932         CDS       T05929                                 
Symbol
Camk2d
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04012  ErbB signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04114  Oocyte meiosis
mpah04217  Necroptosis
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04934  Cushing syndrome
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05214  Glioma
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110320932 (Camk2d)
   04310 Wnt signaling pathway
    110320932 (Camk2d)
   04066 HIF-1 signaling pathway
    110320932 (Camk2d)
   04020 Calcium signaling pathway
    110320932 (Camk2d)
   04024 cAMP signaling pathway
    110320932 (Camk2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110320932 (Camk2d)
   04217 Necroptosis
    110320932 (Camk2d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110320932 (Camk2d)
   04922 Glucagon signaling pathway
    110320932 (Camk2d)
   04912 GnRH signaling pathway
    110320932 (Camk2d)
   04921 Oxytocin signaling pathway
    110320932 (Camk2d)
   04916 Melanogenesis
    110320932 (Camk2d)
   04925 Aldosterone synthesis and secretion
    110320932 (Camk2d)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110320932 (Camk2d)
  09154 Digestive system
   04971 Gastric acid secretion
    110320932 (Camk2d)
  09156 Nervous system
   04725 Cholinergic synapse
    110320932 (Camk2d)
   04728 Dopaminergic synapse
    110320932 (Camk2d)
   04720 Long-term potentiation
    110320932 (Camk2d)
   04722 Neurotrophin signaling pathway
    110320932 (Camk2d)
  09157 Sensory system
   04740 Olfactory transduction
    110320932 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    110320932 (Camk2d)
  09158 Development and regeneration
   04360 Axon guidance
    110320932 (Camk2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110320932 (Camk2d)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320932 (Camk2d)
   05205 Proteoglycans in cancer
    110320932 (Camk2d)
  09162 Cancer: specific types
   05214 Glioma
    110320932 (Camk2d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110320932 (Camk2d)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110320932 (Camk2d)
   05022 Pathways of neurodegeneration - multiple diseases
    110320932 (Camk2d)
  09165 Substance dependence
   05031 Amphetamine addiction
    110320932 (Camk2d)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110320932 (Camk2d)
   05415 Diabetic cardiomyopathy
    110320932 (Camk2d)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110320932 (Camk2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110320932 (Camk2d)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110320932 (Camk2d)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110320932 (Camk2d)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 110320932
NCBI-ProteinID: XP_021052658
Ensembl: MGP_PahariEiJ_G0027058
LinkDB
Position
4:114718459..114966033
AA seq 529 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSW
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggcttcgaccaccacctgcacccggttcaccgacgagtatcagcttttcgaggagctc
ggaaagggagcattctcagtggtgagaagatgtatgaaaattcctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaagg
gaagccagaatctgccgtctcttgaagcatcccaatattgtgagacttcatgacagtata
tcagaagaaggcttccattacttggtgtttgacttagtgactggtggcgaactgtttgaa
gacatagtggcaagagaatattacagtgaagctgatgccagtcattgcattcagcagatc
ctggaggctgtgctacactgccatcagatgggcgtagtccatcgggaccttaagcctgag
aatttgcttttagctagcaagtccaaaggagcagctgtgaagctggcagacttcggctta
gccatagaagttcaaggcgaccagcaggcgtggtttggttttgctggcacacctgggtat
ctttctccagaagtcctgcgtaaagacccttatggaaaaccagtggatatgtgggcatgc
ggcgtcatcctctacatcttgctggtgggatacccacccttctgggatgaagatcagcat
agactgtatcagcagatcaaggctggagcgtatgattttccgtcaccagaatgggataca
gtgacacctgaagccaaagacctcatcaacaaaatgctgaccatcaaccctgccaaacgc
atcacagcctctgaggccctgaaacacccatggatctgtcaacgctctactgttgcgtcc
atgatgcacaggcaggagactgtagactgcttgaagaaatttaatgctagacggaaattg
aagggcgccatcttgacaactatgctggctacgagaaatttttcagcagccaagagtttg
ttgaagaaaccagatggggtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaacattcctaccccggcgctggagccccaaactactgtaatccacaaccctgacgga
aacaaggagtcaactgagagctcaaacaccaccattgaggatgaagacgtgaaagcacga
aaacaggagatcatcaaagtcacggagcaactgattgaagctatcaacaatggggacttt
gaggcttacacaaaaatctgtgatccgggcctcactgcctttgaacctgaagcattgggc
aacttagtggaagggatggactttcacagattctactttgaaaatgctttgtccaaaagc
aataaaccaatccacactatcatcctcaaccctcatgtacacctagtaggggatgatgca
gcctgcatagcatacattcggctcacacagtacatggatggaagtggaatgccaaagact
atgcagtcagaagagactcgtgtgtggcaccgccgtgatgggaagtggcagaatgttcac
tttcatcgttcggggtccccaacagtacccatcaagccaccctgtattccaaatgggaaa
gagaacttctcaggaggcacctcttggtga

KEGG   Mus pahari (shrew mouse): 110325574
Entry
110325574         CDS       T05929                                 
Symbol
Camk2g
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04012  ErbB signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04114  Oocyte meiosis
mpah04217  Necroptosis
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04934  Cushing syndrome
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05214  Glioma
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110325574 (Camk2g)
   04310 Wnt signaling pathway
    110325574 (Camk2g)
   04066 HIF-1 signaling pathway
    110325574 (Camk2g)
   04020 Calcium signaling pathway
    110325574 (Camk2g)
   04024 cAMP signaling pathway
    110325574 (Camk2g)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110325574 (Camk2g)
   04217 Necroptosis
    110325574 (Camk2g)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110325574 (Camk2g)
   04922 Glucagon signaling pathway
    110325574 (Camk2g)
   04912 GnRH signaling pathway
    110325574 (Camk2g)
   04921 Oxytocin signaling pathway
    110325574 (Camk2g)
   04916 Melanogenesis
    110325574 (Camk2g)
   04925 Aldosterone synthesis and secretion
    110325574 (Camk2g)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110325574 (Camk2g)
  09154 Digestive system
   04971 Gastric acid secretion
    110325574 (Camk2g)
  09156 Nervous system
   04725 Cholinergic synapse
    110325574 (Camk2g)
   04728 Dopaminergic synapse
    110325574 (Camk2g)
   04720 Long-term potentiation
    110325574 (Camk2g)
   04722 Neurotrophin signaling pathway
    110325574 (Camk2g)
  09157 Sensory system
   04740 Olfactory transduction
    110325574 (Camk2g)
   04750 Inflammatory mediator regulation of TRP channels
    110325574 (Camk2g)
  09158 Development and regeneration
   04360 Axon guidance
    110325574 (Camk2g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110325574 (Camk2g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325574 (Camk2g)
   05205 Proteoglycans in cancer
    110325574 (Camk2g)
  09162 Cancer: specific types
   05214 Glioma
    110325574 (Camk2g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110325574 (Camk2g)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110325574 (Camk2g)
   05022 Pathways of neurodegeneration - multiple diseases
    110325574 (Camk2g)
  09165 Substance dependence
   05031 Amphetamine addiction
    110325574 (Camk2g)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110325574 (Camk2g)
   05415 Diabetic cardiomyopathy
    110325574 (Camk2g)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325574 (Camk2g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110325574 (Camk2g)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110325574 (Camk2g)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110325574 (Camk2g)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 ABC1 RIO1
Other DBs
NCBI-GeneID: 110325574
NCBI-ProteinID: XP_021059301
Ensembl: MGP_PahariEiJ_G0030014
LinkDB
Position
8:complement(12347375..12406992)
AA seq 588 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVH
LMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPL
RTGNGSLVPEGRSPRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYT
KICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIA
YIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagcttttcgaggagctc
ggcaagggtgccttctcagtggtccggaggtgtgtgaagaaaacatctacgcaggaatat
gctgcaaaaatcatcaataccaagaagttgtccgcccgagatcatcagaaactagaacga
gaggcccggatatgccgacttctgaaacatccgaacattgtgcgtctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggaggggagttgtttgaa
gatattgtggccagagagtactacagtgaagctgatgccagccactgtatacatcagatc
ctggagagtgttaaccacatccaccagcatgatatcgtccacagggacctgaagcctgaa
aacttgctgctggcaagtaaatgcaagggtgctgcggtcaagctagctgattttggcctg
gccatcgaagtgcagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaagctggagcctacgatttcccatcaccagaatgggacacg
gtcactcctgaagctaagaacttgatcaaccagatgttgaccataaaccctgcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacggtctacagtggcatcc
atgatgcatcgccaagagacggtagagtgcttacgcaaattcaacgcccggagaaaactg
aagggtgccatcctcacaaccatgctggtctccaggaacttctcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcagatggcggtgtcaagaaaaggaagtcgagttccagcgtgcac
ctaatgccacagagcaacaacaaaaacagtctcgtaagcccagcccaagagcctgcgccc
ttgcagacggccatggaaccacaaaccaccgtggtacataatgctacagatgggatcaag
ggctccacagagagctgtaacaccactacagaagatgaagatctcaaagctgccccgctc
cgcactgggaatggcagcttggtgcctgaaggacggagcccccgggacagaacagccccc
tctgcaggcatgcagccccagccttctctctgctcctcagccatgagaaaacaggaaatc
attaagatcacagaacaactgatcgaagccatcaacaatggggactttgaggcctacacg
aagatttgtgacccgggcctcacttcctttgagccagaagcccttggtaacctcgtggaa
ggaatggatttccataagttttactttgagaatctcctgtccaagaacagcaagcccatc
cacaccaccatcctaaacccacacgtccacgtgatcggggaggacgcagcttgcatcgcc
tatatccggctcactcagtacatcgacgggcagggtcggcctcgtaccagtcagtcagag
gagacccgggtgtggcaccgccgggacggcaagtggctcaatgtccactatcactgctca
ggggcccctgctgcaccgctacagtga

KEGG   Mus pahari (shrew mouse): 110331006
Entry
110331006         CDS       T05929                                 
Symbol
Camk2b
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04012  ErbB signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04114  Oocyte meiosis
mpah04217  Necroptosis
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04934  Cushing syndrome
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05214  Glioma
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110331006 (Camk2b)
   04310 Wnt signaling pathway
    110331006 (Camk2b)
   04066 HIF-1 signaling pathway
    110331006 (Camk2b)
   04020 Calcium signaling pathway
    110331006 (Camk2b)
   04024 cAMP signaling pathway
    110331006 (Camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110331006 (Camk2b)
   04217 Necroptosis
    110331006 (Camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110331006 (Camk2b)
   04922 Glucagon signaling pathway
    110331006 (Camk2b)
   04912 GnRH signaling pathway
    110331006 (Camk2b)
   04921 Oxytocin signaling pathway
    110331006 (Camk2b)
   04916 Melanogenesis
    110331006 (Camk2b)
   04925 Aldosterone synthesis and secretion
    110331006 (Camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110331006 (Camk2b)
  09154 Digestive system
   04971 Gastric acid secretion
    110331006 (Camk2b)
  09156 Nervous system
   04725 Cholinergic synapse
    110331006 (Camk2b)
   04728 Dopaminergic synapse
    110331006 (Camk2b)
   04720 Long-term potentiation
    110331006 (Camk2b)
   04722 Neurotrophin signaling pathway
    110331006 (Camk2b)
  09157 Sensory system
   04740 Olfactory transduction
    110331006 (Camk2b)
   04750 Inflammatory mediator regulation of TRP channels
    110331006 (Camk2b)
  09158 Development and regeneration
   04360 Axon guidance
    110331006 (Camk2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110331006 (Camk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331006 (Camk2b)
   05205 Proteoglycans in cancer
    110331006 (Camk2b)
  09162 Cancer: specific types
   05214 Glioma
    110331006 (Camk2b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110331006 (Camk2b)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110331006 (Camk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    110331006 (Camk2b)
  09165 Substance dependence
   05031 Amphetamine addiction
    110331006 (Camk2b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110331006 (Camk2b)
   05415 Diabetic cardiomyopathy
    110331006 (Camk2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331006 (Camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331006 (Camk2b)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110331006 (Camk2b)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110331006 (Camk2b)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH SnoaL_2 Pkinase_fungal Kdo SnoaL_4
Other DBs
NCBI-GeneID: 110331006
NCBI-ProteinID: XP_021066978
Ensembl: MGP_PahariEiJ_G0016826
LinkDB
Position
13:23287445..23380147
AA seq 666 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQANSTK
NSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKAPRVPDVLSLVR
RGSGAPEAEGPLSCPSPVPISPLPAPSPRISDILNSVRRGCGTPEAEGPLSVGPPPCLSP
GLLGPLPTPSPRISDILNSVRRGSGTPEAEGLPPVGPPPCPSPTLPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgtttcactgacgagtaccagctatacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgtaccggccatgagtat
gcagccaagatcattaataccaagaagctgtcggccagagatcaccagaaactggagaga
gaggctcggatctgccgcctgctgaagcattccaacattgtacgtctccatgacagcatc
tctgaagagggcttccactacctggtcttcgatctggtcaccggtggggagctctttgaa
gacatcgtggcaagagagtactacagcgaggctgatgccagtcactgcatccagcagatc
ctggaggctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagcctgag
aacctgcttctggccagcaaatgcaaaggcgccgcggtgaagctggcagactttggcctg
gccatcgaggttcagggagaccagcaggcatggtttggatttgcgggaacaccaggctac
ctgtctcccgaggtccttcggaaggaggcctacggcaaacctgtggacatctgggcatgt
ggggtgatcctgtatatcctgctggtgggctacccacctttctgggatgaggaccagcac
aagctgtaccagcagatcaaggctggggcgtatgatttcccatcccctgagtgggacacc
gttactcctgaagccaaaaacctcatcaaccagatgttgaccatcaaccctgccaagcgc
atcacggcccatgaggccctgaagcacccatgggtctgccaacgctccaccgtggcctct
atgatgcacagacaggagactgtggaatgtctgaagaagttcaatgcaaggaggaagctc
aagggagccatcctcaccactatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccaggcaaacagcaccaaa
aacagctcggccatcaccagccccaaaggatccctccctcctgctgccctggagcctcaa
accaccgttatccataacccagtggacgggattaaggaatcttccgacagcaccaacaca
accatagaggatgaagatgccaaagcccccagggtccctgatgtcctgagcttggtgagg
aggggctcaggagccccagaagccgagggccccctctcctgcccatctccagttcccatt
agcccccttccagccccgtcccccaggatctctgacatcctgaactcagtgaggcggggc
tgtggaaccccagaagccgagggacccctatcagtggggcccccaccctgcttgtctccg
ggtctcctaggccccctgcccaccccgtcccccaggatctctgacatcctgaactcagtg
aggcggggctcagggaccccggaagccgagggcctcccaccagtgggccccccaccctgc
ccgtctccgactctccctggccccttgcccaccccatcccggaagcaggagatcatcaag
accacagagcagctcattgaggccgtcaacaatggggactttgaggcctatgcgaaaatc
tgtgacccaggcctgacctcatttgagcctgaagctctgggcaacttggtcgaagggatg
gatttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacc
accatcctgaacccgcacgtgcacgtcattggtgaggatgcagcatgcatcgcctacatc
cgcctcacacagtacatcgatggccagggcagaccccgtaccagccagtccgaagagacc
cgtgtgtggcaccgccgcgatggcaagtggcagaatgtacatttccactgctcgggcgct
ccagtggccccgctgcagtga

KEGG   Mus pahari (shrew mouse): 110332832
Entry
110332832         CDS       T05929                                 
Symbol
Camk2a
Name
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04012  ErbB signaling pathway
mpah04020  Calcium signaling pathway
mpah04024  cAMP signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04114  Oocyte meiosis
mpah04217  Necroptosis
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04728  Dopaminergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04916  Melanogenesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04934  Cushing syndrome
mpah04971  Gastric acid secretion
mpah05012  Parkinson disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05214  Glioma
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110332832 (Camk2a)
   04310 Wnt signaling pathway
    110332832 (Camk2a)
   04066 HIF-1 signaling pathway
    110332832 (Camk2a)
   04020 Calcium signaling pathway
    110332832 (Camk2a)
   04024 cAMP signaling pathway
    110332832 (Camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110332832 (Camk2a)
   04217 Necroptosis
    110332832 (Camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110332832 (Camk2a)
   04922 Glucagon signaling pathway
    110332832 (Camk2a)
   04912 GnRH signaling pathway
    110332832 (Camk2a)
   04921 Oxytocin signaling pathway
    110332832 (Camk2a)
   04916 Melanogenesis
    110332832 (Camk2a)
   04925 Aldosterone synthesis and secretion
    110332832 (Camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110332832 (Camk2a)
  09154 Digestive system
   04971 Gastric acid secretion
    110332832 (Camk2a)
  09156 Nervous system
   04725 Cholinergic synapse
    110332832 (Camk2a)
   04728 Dopaminergic synapse
    110332832 (Camk2a)
   04720 Long-term potentiation
    110332832 (Camk2a)
   04722 Neurotrophin signaling pathway
    110332832 (Camk2a)
  09157 Sensory system
   04740 Olfactory transduction
    110332832 (Camk2a)
   04750 Inflammatory mediator regulation of TRP channels
    110332832 (Camk2a)
  09158 Development and regeneration
   04360 Axon guidance
    110332832 (Camk2a)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110332832 (Camk2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332832 (Camk2a)
   05205 Proteoglycans in cancer
    110332832 (Camk2a)
  09162 Cancer: specific types
   05214 Glioma
    110332832 (Camk2a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110332832 (Camk2a)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110332832 (Camk2a)
   05022 Pathways of neurodegeneration - multiple diseases
    110332832 (Camk2a)
  09165 Substance dependence
   05031 Amphetamine addiction
    110332832 (Camk2a)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110332832 (Camk2a)
   05415 Diabetic cardiomyopathy
    110332832 (Camk2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110332832 (Camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110332832 (Camk2a)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110332832 (Camk2a)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110332832 (Camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 110332832
NCBI-ProteinID: XP_021069799
Ensembl: MGP_PahariEiJ_G0019045
LinkDB
Position
15:54723732..54783753
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctaccatcacctgcacccgattcacagaagagtaccagctctttgaggaactggga
aagggagccttctctgtggtgcgcaggtgtgtgaaggtgctggctggtcaggagtatgct
gccaagattattaacaccaagaaactctcagccagagatcaccagaagctggagcgcgag
gcccgcatctgccgcttgttgaagcaccccaatatcgtccgactccatgacagcatctcc
gaggaggggcaccactaccttatcttcgatctggtcactggtggggagctgtttgaagac
attgtggcccgggagtattacagtgaagctgatgccagccactgtatccagcagatcttg
gaggctgtgctacactgtcaccagatgggggtggtgcatcgtgacctgaagcctgagaat
ctgttgctggcttcgaagctcaagggtgctgctgtgaaactggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggttcgcagggacacctggatacctc
tccccagaagtgctgaggaaggacccgtacgggaagcccgtggacctgtgggcctgtggc
gtcatcctgtatatcttgctggttgggtatcccccgttctgggacgaggaccagcaccgc
ctgtaccagcagatcaaagctggtgcctatgatttcccatcaccagaatgggataccgtc
accccggaagccaaggatctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggctgctgaagctctcaagcacccatggatctcgcaccgctccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggagaaaactgaag
ggagccatcctcaccactatgctggccaccaggaacttctccggagggaagagcggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttctgagagtaccaacaccaccatcgaggacgaagacaccaaagtgcgcaaacaggaa
attatcaaagtgacagagcagctgatcgaagccataagcaatggagactttgagtcctac
acgaagatgtgcgaccctggaatgacagccttcgaaccggaggccctggggaacctggtg
gagggcctggactttcatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaaccctcacatccacctgatgggtgacgagtcagcctgcatc
gcctacatccgcatcactcagtacctggatgcaggaggcatcccccgcacggcccagtca
gaggagacccgtgtctggcaccgcagggacggcaaatggcagatcgtccacttccacaga
tctggggcaccctccgtcctgccgcattga

DBGET integrated database retrieval system