KEGG   Mus pahari (shrew mouse): 110321338
Entry
110321338         CDS       T05929                                 
Symbol
Cntn2
Name
(RefSeq) contactin-2
  KO
K06760  contactin 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321338 (Cntn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110321338 (Cntn2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110321338 (Cntn2)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Contactins
   110321338 (Cntn2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Others
  110321338 (Cntn2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 C2-set Izumo-Ig Arylsulfotran_N Interfer-bind
Other DBs
NCBI-GeneID: 110321338
NCBI-ProteinID: XP_021053210
Ensembl: MGP_PahariEiJ_G0027826
LinkDB
Position
5:complement(106759016..106789831)
AA seq 1040 aa
MGAPVRKGASLLLVVLATVALISSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVT
LACRARASPPATYRWKMNGTDMNLEPGSRHQLMGGNLVIMSPTKAQDAGVYQCLASNPVG
TVVSKEAVLRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIP
TDGRHFVSQTTGNLYIARTNASDLGNYSCLATSHLDFSTKSVFSKFAQLNLAAEDPRLFA
PSIKARFPPETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWGTAEPTLQIPSVSF
EDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPMV
RWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPD
FRQNPVRRLIPAARGGEISIPCQPRAAPKATILWSKGTEILGNGTRVTVTLDGTLIIRNI
SRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGDNLTLQCHASHDPTM
DLTFTWTLDDFPVDFDKPGGHYRRASVKETIGDLTILNAQLRHGGKYTCMAQTVVDGASK
EATVLVRGPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIAKYTLQARTPPSGKWKQVRT
NPVNIEGNAETAQVLGLMPWMDYEFRVSASNILGTGEPSGPSSKIRTKEAVPSVAPSGLS
GGGGAPGELTINWTPMSREYQNGDGFGYLLSFRRQGSSSWQTARVPGADTQYFVYSNDSI
HPYTPFEVKIRSYNRRGDGPESLTTIVYSAEEEPKVAPAKVWAKGSSSSEMNVSWEPVLQ
DMNGILLGYEIRYWKAGDKEAAADRVRTAGLDSSARVTGLYPNTKYHVTVRAYNRAGTGP
ASPSADAMTMKPPPRQPPGNISWTFSSSSLSLKWDPVVPLRNESTVTGYKMLYQNDLHPT
PMLHLTSKNWIEIPVPEDIGHALVQIRTTGPGGDGMPAEVHIVRNGGTSMMVESAAVRPA
HPGPVFSCMVILMLAGCQRL
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgggagcaccggtcaggaaaggggcaagcttgctgctggtggtgctggccacagtggct
ctgatctcctctccaggatggagtttttcccagggaaccccagctacctttggacccgtc
tttgaagagcaacctgttggcctgctattcccagaggagtctgctgaggatcaggtgaca
ctggcatgccgtgcccgagctagccctccagccacctataggtggaagatgaacggcaca
gatatgaacctggaacctggctcccgtcaccagctgatggggggcaacctggtcatcatg
agtcccaccaaggcacaggatgctggtgtctaccagtgcctagcctctaacccagtaggc
actgtcgtcagcaaggaagctgtcctccgtttcggcttcctacaggaattctccaaggag
gagagggaccccgtgaaaacccacgagggctggggggtgatgctgccctgtaacccacct
gcccattacccaggtttgtcctaccggtggctcctcaatgagttccctaacttcatccca
acggatgggcgtcacttcgtgtcccagaccacagggaacctgtacattgcccgcaccaac
gcctcggacctgggcaactattcttgcctggctaccagccacctggacttctccaccaag
agcgtcttcagcaaattcgcgcagctcaacctggctgctgaagatccccggctctttgct
cccagtatcaaagcccggttccccccagagacctacgcactggttgggcagcaggtcacc
ctggagtgctttgcctttgggaaccctgtccccaggatcaagtggcgcaaagtggatggt
tccttgtcccctcagtggggcacagcagagcccaccctgcagatccccagcgtgagcttt
gaagatgagggtacctacgaatgcgaggcagagaactccaagggccgtgacactgtccag
ggacgcatcattgtgcaagctcagcctgagtggctaaaggtgatctcagacacagaagcc
gacattggctccaacttacgttggggctgcgcagcagcaggcaaaccccggcccatggtg
cgctggctgagaaacggggaacctctggcctcccagaaccgggtggaggtcttggctggg
gacctgcgattttctaagctgagcctggaggactccggcatgtaccagtgtgtggcagaa
aacaagcatggcacgatctatgccagtgctgagctggctgtacaagctctggccccagac
ttcaggcagaaccctgtgaggcggctgatccctgcagcccgagggggagagatcagtatc
ccgtgccagccccgtgcggctccaaaagctaccatactttggagcaagggtactgagatt
ctggggaacggtaccagggtgactgtcactttggatggcaccttgattatcagaaacatc
agtcgatcggacgaaggaaaatacacctgctttgctgagaacttcatgggcaaagccaac
agtactgggatcctgtctgtgcgcgatgcaacgaagatcacgctagctccttctagtgct
gacatcaatgtgggtgataacctgaccctacagtgccacgcctcacatgaccccactatg
gacctcacgttcacctggaccctggatgacttccctgttgactttgataagcctggaggt
cactatcggagagccagtgtgaaggagaccatcggggacctgactatcctgaatgcccaa
ctacgccacggagggaagtacacatgcatggcccagacggtggtagacggtgcatccaaa
gaggccacagtcctggtccgaggtcccccaggtcctcccgggggtgtggtggtgagagac
attggagacaccactgtccagcttagctggagtcgtggctttgacaatcacagccccatt
gccaagtacaccctgcaagcacggactccgccctcagggaaatggaagcaggttcgaacc
aatcctgtgaatatcgagggcaatgccgagactgctcaggtgctgggactcatgccttgg
atggactatgagtttcgggtttcagctagcaacatcttgggcactggggagcccagcggc
ccctccagcaaaatccgcactaaggaagcagtcccctctgtggcaccatcaggactcagt
ggaggaggaggagcccctggagagcttaccatcaactggactcccatgtcacgggagtac
cagaatggagacggcttcggctacctgctgtccttccgcaggcaaggcagctccagttgg
cagacggcccgggtgcccggcgctgatacccagtacttcgtctacagcaatgacagcatc
catccctacacaccctttgaggtcaagatccgaagctacaatcgccggggggatgggcct
gagagcctcactaccatcgtgtactcagcagaggaagagcccaaggtggcccctgccaag
gtctgggccaagggttcctcatcctcagagatgaacgtgagctgggagcctgtgctacaa
gacatgaatggcattctcctggggtatgagattcgctactggaaagctggggacaaagaa
gcagccgctgaccgagtgaggacggcagggctagactccagtgcccgagtcaccggcctg
taccccaacaccaagtaccacgtaactgtgagggcctacaaccgggctggcaccggacca
gctagcccttcagccgatgccatgaccatgaagcccccgccacggcaacctcctggcaac
atctcttggactttctcaagttccagcctcagccttaagtgggaccctgtggttcctctc
cgaaatgaatctacagtcactggctacaagatgctgtatcagaatgacctgcacccaact
cctatgctccacctcaccagcaagaactggatagaaataccagtacctgaagacatcggt
cacgctctggtgcagattcgaaccacggggcctggaggggatgggatgccagccgaagtc
cacattgtgagaaatggaggcaccagcatgatggtggagagcgcagccgtccgccccgcc
catcctggtcccgtgttctcctgcatggttatactgatgctcgccggctgccagaggctc
tga

DBGET integrated database retrieval system