KEGG   Mus pahari (shrew mouse): 110321463
Entry
110321463         CDS       T05929                                 

Gene name
Gli2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah04390  Hippo signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110321463 (Gli2)
   04390 Hippo signaling pathway
    110321463 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321463 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110321463 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110321463 (Gli2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110321463 (Gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 110321463
NCBI-ProteinID: XP_021053359
Ensembl: MGP_PahariEiJ_G0027746
LinkDB
Position
5
AA seq 1549 aa
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAAAAVAAQGVPQQLLPAFHAP
LPIDMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSTHHPY
MNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPATNPSDYYHQMT
LMASHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDA
SLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILS
QQRGLGSSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLGSSSSNCLNDANQNKQNSE
SAVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYE
TNCHWADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRR
HTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNR
THSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDN
EASAEPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGS
APNNDSGMEMPGTGPGSLGDLTALDDTSPGADTSALAAPSTGGLQLRKHMTTMHRFEQLK
REKLKSLKDSCSWAGPAPHTRNTKLPPLPANGSVLENFNNTGGGGPAGLLPSQRLPELTE
VTMLSQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSY
DPISTDASRRSSEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLR
TRLALLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGHGYVGAAPAFPHEGPNSSTRR
ASDPVRRPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSIDSNLTRNAYSPRP
PSINENVVMEAVAAGVDGPGLECDLGLVEDDLVLPDDVVQYIKAHTGGTLDDGTRQGYPT
EGTGFPENSKLPSPVLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNE
VSSGTVDALPTQVKPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRG
APSASRGSYTQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNVVSASLNQFSPSCSN
MAAKPSHLGLPQQMEVVPNATIMSGHQRELGVPNSSLAAVSQPHPVLSYPQQDSYQQGSN
LLSSHQPSFMESQQNTGFGLMQPRPPPEPNTASRHRGVRSGQQQLYARTAGQAMVTSANQ
ETAEAMPKGPAGTVVTLAPQPPQDTGRAQDQNTLYYYGQIHMYEQNGGCPAMQPQPPQPQ
ACSDNIQTEPLPSPGVNQVSSTVDSQLLEPPQIDFDAILDDGDHSSLFSGALSPTLLHNL
SQNSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEENKFLNMMT
NT seq 4650 nt   +upstreamnt  +downstreamnt
atggagacttcggccccagcccctgcactggagaagaaagaagccaagagtggtctcttg
gaggacagcagctttcccgacccagggaaaaaggcctgtcctctggcggtggccgcggcg
gccgcagctgtagctgcccaaggagttcctcagcagctcctgccggctttccacgcgcct
ttgccgattgacatgagacaccaggagggaaggtaccattatgaccctcactctgtccac
agtgtacacgggcctcccaccctaagtggcagccctgtcatctcagatatctccttgata
cggctttctccacaccccgctggccctggagaatcacccttcagcacccaccacccctac
atgaacccccatatggagcattacctccggtctgtgcacagcagccccacactctcaatg
atctctgccgccaggggcctcagccctgctgatgtggcccacgaacatctgaaagagagg
ggactatttagcctcgctgccccagccaccaacccttcagactattaccaccagatgacc
ctcatggcaagccaccccacaccctatggggaccttctaatgcagagtgggggtgctgct
agcgcaccccatctccatgactacctcaaccctgtggatgcgtcacgattctctagtcca
cgtgtgactcctcgactgagccgcaagcgggctctatccatctccccgctctcagatgcc
agcctcgacctacaacgcatgattcggacctctcccaactcgctggtagcttacatcaac
aactccaggagcagctcagcagccagtggctcttatggacatctgtcggccggtgccctc
agcccagccttcactttcccccaccccatcaatcccgtggcctaccagcagatcctgagc
cagcagcggggcctgggctcatcagcctttggacacacaccacccctgatccagccttca
cccaccttcctggcccagcagcccatgactctcacttccatcagcaccatgcctacccaa
cttggcagcagtagcagcaactgtctaaatgatgccaatcagaacaagcagaacagcgag
tcagctgtgagcagcaccgtgaaccccatcaccattcataagcggagcaaggtcaagact
gaggctgagggcctgcgtccagcctctcctcttggactgacacaggagcagctggccgat
ctcaaggaagacctggacagggatgactgtaagcaggaggccgaggtggtcatctacgag
accaactgccactgggcagactgcaccaaggaatatgacacacaggagcagctggtgcat
catatcaacaatgagcacatccatggagagaagaaggagttcgtgtgccgctggcaggcc
tgcacgagagagcagaaacccttcaaggcccagtacatgctggtcgttcacatgcgcaga
cacacgggtgagaagccacacaagtgcacgttcgaaggctgctccaaggcctactctcgc
ctggagaacctgaagacacacctgcgttcgcacacaggggagaagccatatgtgtgtgaa
catgaaggctgtaacaaggccttctccaatgcctcggaccgcgccaagcaccagaaccgc
actcactccaatgagaaaccctacatctgcaagatcccaggctgcaccaagaggtacaca
gaccccagctcactgcgcaagcatgtgaagaccgtccatgggccagacgcccatgtcacc
aagaaacagcgtaatgatgtgcacgtccgtgctccactgctcaaggagaatggggacaat
gaggccagcgctgagccaggtggccggggacctgaggagagtgtggaggccagtagcacc
agccacactgtggaggactgcctacatatcaaagccatcaagacagagagctccgggctg
tgtcagtccagccccggagcccagtcatcctgtagcagcgagccctctcccctgggcagt
gcccccaacaatgacagtggcatggagatgcccgggacagggcccgggagtctgggagac
ctgacagcactggatgacacgtctccaggagctgacacctcagccctggctgcaccctcc
actggtggcctgcagctgcgcaaacacatgaccaccatgcatcgctttgagcagctgaag
agagagaagctcaagtcactaaaggattcctgctcatgggccggcccagctccacacacc
cgcaacaccaagctgcctccccttccagccaatggatctgtcctggaaaacttcaacaat
actgggggcggtggaccagcgggactgctgcccagccagcggctaccagagctgaccgaa
gtgacgatgctgagccagctgcaggaacgaagggacagctccactagcaccatgagctcg
gcctacactgtgagccgccgctcctctggcatctccccatacttctccagccgtcgctcc
agcgaggcttcgcctctcggtggcctacgcccacacaacgccagctcagcggactcctat
gaccccatctccacagatgcctctcggcgctccagtgaggccagccagtgcagcggcggt
ggcccagggctgctcaacctcacacctgcacagcagtacaacctgcgtgccaagtacgca
gcggctacaggtggaccaccacccacgccactgccgggcctcgatcgcgtaagccttcgt
acccgcctagcgttactggatgctcctgagcgtgcactgcctggcgcctgcccacatcca
ctggggccacggcgtggcagcgatgggcctacctatagccacggtcatggtcatggccat
ggctacgtaggtgcggctcctgccttcccccacgaggggccaaacagcagcacacggcgg
gccagcgaccctgtgcggcgccctgacccccttattctgcctcgagtgcaacgtttccat
agtacccacaacatgaatccaggttcactgccaccctgcgctgatcggcgtggcctgcac
gtacagagccaccccagcatagacagcaacctgacccgcaacgcctactctcccagaccc
cctagcatcaatgagaacgtggtgatggaggccgtggctgctggggtagacggtccaggg
ctagagtgcgacctggggctggtggaggatgacctggtgctcccggatgatgtggtccag
tatatcaaggctcacaccggtggtaccttggatgacggcactcggcaggggtatcccaca
gaaggtactggcttccccgagaactctaaactgcccagtccggtgctacaaggccaccgc
aggctagcagctgccgactccaacatgggcccttctgctcctggacttgggggctgccag
ctgagctacagcccctcctccaacctcaacaagagcaacatgcctgtgcagtggaatgag
gtgagttctggcaccgtggatgccctacctacccaggtgaagcctcctttccctcacagc
aacctggctgtggttcaacagaagccggcctttggccagtatccaggatataatccacaa
tctgtgcagagcagctccggaggtctagacagcacccaaccgcacctacagcttcgagga
gccccctctgcatcaagagggagctacacacaacagcctcggcagccagctgcaggcagt
cagtgcctgggtatgagtgcggccatgagcccgcaggccagctacagccaggcccacccc
cagctgagtccaaacgttgtcagcgcatctctgaaccagttttctccctcctgcagcaat
atggcagccaagcccagccacctgggactccctcagcaaatggaagttgtccccaatgcc
accatcatgagtggccatcagcgggagcttggggttcccaattcatccctggctgcagtg
tcacaacctcacccagtcctgagctatccccagcaggacagctaccaacagggctccaac
cttctgtcatcccatcagcctagcttcatggagtcccagcagaacacgggctttggtctc
atgcagcctcggccacccccggaacccaacacggctagccgtcaccgtggagtacgttct
gggcaacagcagttgtatgccaggactgctggccaagccatggtcacatcagctaaccaa
gagacagcagaagctatgcccaagggaccagcagggactgtggtaaccctagctcctcag
ccacctcaggacacagggcgggcacaagatcagaacacgctatactactatggccagatc
cacatgtatgaacagaatggaggctgcccagccatgcagccccagccgccacaaccacaa
gcttgctcagacaatatccaaactgagcctctgccttcaccgggagtcaatcaggtgtcc
agcactgtggactcccagctcctggagcccccccagattgactttgatgccatcttggac
gatggtgatcactcaagtttgttttctggtgcactgagcccaaccctcctccacaatctc
tcccagaattcctcacgcctcaccacaccccggaattccttgacactgccctccatccct
gcgggcatcagcaacatggccgtgggggacatgagttccatgctcaccagcctggctgaa
gagaacaagtttttaaatatgatgacctag

KEGG   Mus pahari (shrew mouse): 110326390
Entry
110326390         CDS       T05929                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110326390 (Gli1)
   04024 cAMP signaling pathway
    110326390 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326390 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110326390 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110326390 (Gli1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110326390 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8 IL17
Other DBs
NCBI-GeneID: 110326390
NCBI-ProteinID: XP_021060449
Ensembl: MGP_PahariEiJ_G0031192
LinkDB
Position
9
AA seq 1110 aa
MFNPMTPPQVNSYGEPCCLRPLHSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGAARETS
SCTEGSLFPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPG
GSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTRGSMMLHPQSRGPRATCQ
LKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGREDLEREEKPEPESVYETDCR
WDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGE
KPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHSN
EKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKRER
EGGSGREESRLTVPEGAMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDLS
SLDEGPCVAATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVSL
DRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENGASSLPGLTPAQHYMLRARYASVRGT
GTPPTAAHSLDRMGGLPVPPWRSRTEYPGYNPNAGVTRRASDPARAADHPAPARVQRFKS
LGCVHTPPSVATGQNFDPHLPTSVYSPQPPSITENVAMDTRGLQEEPEVGTSVMGNGLNP
YMDFSSADTLGYGGPEGTAAEPYEARGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPETW
GEFPSHAGVYPGNKAPGAPYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
SPGPQPMFSHHPQLPQPQYPQSGPYPQPPHGYLSSEPRPGLNFNPSSSHSTGQLKAQLVC
NYVQSQQGLWEGRSRGGLPNQELPYQSPKFLGGSQVSQSPAKTPAVAAAAAAYGSGFAPA
SANHKSGSYPAPSQCHETFTVGVNRPSHRPAPPRLLPPLSPCYGPLKVGDTNPSCGHPEV
GRLGAGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDETQGLSPPLSHEQGDSSKNTPP
PSGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgttcaatccaatgactccgccacaagtcaatagctatggtgaaccatgttgtctccga
cccctccacagtcaaggagtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaactttatgtcagggtcccagggttatggagcagccagagagaccagc
agctgcactgaaggatctctctttcctcctcctcctcctcggagttcagtcaaattaaca
aagaagcgggctctctccatttcgcccctctcggatgccagcctcgacctacaaaccgta
atccggacctcacccagctccctcgtggctttcatcaactctcgctgtacatctccgggc
ggttcctacggccatctctccattggcaccatgagcccttctttaggattcccacctcag
atgagtcatcaaaaaggaacttcacctccctatggagtccagccctgtgttccacatgac
tctactcggggttcaatgatgcttcacccccagtcccggggaccacgtgcaacctgccag
ctgaagtcagagctggacatgatggttggcaagtgcccggaggaccctttggaaggggac
atgtctagccccaactccacaggcacacaggatcacctgctggggatgctggatgggcgg
gaggacctggagagagaggagaaacctgagcctgagtctgtgtatgagacagactgccgc
tgggatggttgcagccaggagttcgattcccaggagcagctggtgcaccacatcaacagt
gagcatatccacggggagcggaaggaatttgtgtgccactggggaggttgctccagagag
ctgagacccttcaaggcccaatacatgctggtggtgcacatgcgcagacacacgggcgag
aagccgcacaagtgcacgtttgaaggctgtcggaagtcctattcacgcctcgaaaacctc
aagacgcacctgcggtcgcacacgggcgagaagccttacatgtgtgagcaagaaggttgc
agcaaggcctttagcaatgccagtgaccgcgccaagcaccagaatcggacccactccaat
gagaagccatacgtgtgcaagctccccggctgcaccaagcgctacacagatcccagctcg
ctccgcaaacacgtcaagacagtgcacggtccggatgcccacgtgaccaagcggcatcga
ggggatggccccttgccacgggcgcagcccctctctacagtggagcccaagcgggaaagg
gaaggaggatcaggcagggaagagagcagactgactgtgcccgagggtgccatgccacag
cagagccccggagcacaatcctcctgcagcagcgaccactccccagcaggcagtgcggcc
aacacggacagcggcgtggagatggccggcaacgccgggggcagcactgaggacttgtcc
agcttggatgaaggaccttgtgttgcggccaccggactttccacgcttcgccgcctggag
aacctcaggctggatcagctgcatcagctccgaccaatagggtctcggggtctcaaactg
cccagcttaacccacgcaggcgcacctgtgtctcgccgtctgggccccccagtctccctt
gaccgccgcagcagcagctccagcagcatgagctctgcttacacagtcagccgcaggtcc
tccctagcatcccctttcccgccgggaaccccaccagagaatggggcatcgtcactacct
ggcctcacacctgctcagcactacatgctccgtgccagatatgcttcagtcagggggact
ggcaccccgcccactgcagcgcacagcctggaccggatgggaggtcttcctgttcctcct
tggagaagccggaccgaatacccgggatacaacccaaatgcaggggtcactcggagggcc
agtgacccagcgcgggctgcagaccacccagctccagccagagtccaacggttcaagagc
ctgggatgtgtccacacgccccctagtgtggcaacgggacagaacttcgatccccacctc
cctacctccgtctattcgccacagccccccagcatcaccgaaaatgttgccatggatact
agggggctacaggaggagccagaagttggaacttctgtgatgggcaatggtctgaaccca
tacatggatttttcctccgctgataccctgggatatggggggcctgaggggacggcagct
gagccttatgaagctaggggtccaggttccctgcctcttgggcctggtccaccaaccaac
tatggccctggccactgtgctcagcaggtctcctatcctgatcccaccccagaaacatgg
ggtgagtttccttctcatgctggggtgtaccctggcaataaggctcctggtgctccctat
agccagtgtcctcgacttgagcattatggacaagtgcaggtaaaaccagaacaagggtgc
cccgtggggtctgactccaccggattggcaccctgcctcaatgcccaccccagtgaaggg
tccccaggcccgcagcctatgttttcacatcacccccagctccctcagccccagtatccc
caatcgggtccctatcctcagcctccccatggttatctctcatcagaacccaggcctggc
ctcaattttaacccctcctcctctcattccacaggacagctcaaagctcagctcgtgtgt
aattacgttcagtcgcagcagggactgtgggagggaagaagccggggagggctccccaac
caggaactcccataccagagccccaagtttctggggggttcccaagttagtcagagccct
gccaagaccccagcagtagcagcagcagcagcagcatatggatctggctttgcacctgct
tcggccaatcacaaatcaggctcctatcctgccccttcgcagtgccatgaaactttcacc
gtgggagtaaacaggccttcccacaggccagcaccaccccgacttctgcccccactgtcc
ccttgctatgggcccctcaaggtgggggataccaaccccagttgtggccatcctgaggtg
ggcaggttaggagcaggccctgccttgtaccctccccctgaagggcaggtgtgtaacccg
ctggactctcttgacctggacaacactcagctggactttgtggcaatcctagatgagacc
cagggcctgagccctcctctttcccatgagcaaggggacagctctaaaaacaccccaccc
ccctctgggccccccaacatggcagtgggtaacatgagtgtcttgctggggtctctgcct
ggagagactcaattcctcaactctagtgcctaa

KEGG   Mus pahari (shrew mouse): 110333582
Entry
110333582         CDS       T05929                                 

Gene name
Gli3
Definition
(RefSeq) transcriptional activator GLI3
  KO
K06230  zinc finger protein GLI3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110333582 (Gli3)
   04024 cAMP signaling pathway
    110333582 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333582 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110333582 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110333582 (Gli3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110333582 (Gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 110333582
NCBI-ProteinID: XP_021070847
Ensembl: MGP_PahariEiJ_G0019291
LinkDB
Position
16
AA seq 1583 aa
MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITM
QPQSVQGLNKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELSTTTSKREECLQVKTVKAEKPMASQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRSDLSGVDFTV
LNTLNRRDSSTSTVSSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTKMALL
GEGRDSGVTLPPVHPPRRCSDGGGHAYRGRHLMHHDAVANSVRRASDPVRTVSENMSLPR
IQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQESSQPRYFQASPCPPSITENVALEALTM
DADANLNDEDFLPDDVVQYLNSQNQTGYGQQLQSSISEDSKVAHEPEDLDLPGLPDSHIG
QQYPALEQPCSEGSKTDLPIQWNEVSSGSSDLSSSKLKCGQQRPSVQQPRGFGLYNNMVV
HPHNLWKVGTGPAGGYQTLGENSSAYNGPEHFAIHTGEGLGTNGNTFHEQPYKTQQCGSQ
LNRQPLTSSALDHACGAGIQGSKLKGNSLQENGGLLDFGLSVAPNELAGNTVNGIQTQDQ
VGQGYFAHQLLSGSVQHQGPSRPGQQVLGQIGATSHINIYQGTESCLPGTQDNSSQPSRM
AAIRGYQPCSSYGGNRRQAMPRGNLTLQPGQLSDVSQSSRVNSIKMEAQGQSQQLCSNMQ
TYSGQFYDQTVGFGQQDRKAGSFSLSDADCLLQGNGTENSELLSPGANQVTSTVDSFESH
DLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMGTSNM
AIGDMSSLLTSLAEESKFLAVMQ
NT seq 4752 nt   +upstreamnt  +downstreamnt
atggaggcccaggcccacagctctacggcgactgagaggaagaaagctgaaaattccatt
gggaaatgtcccacgagaacagatgtcagcgagaaggccgtggcctctagtaccacttcc
aatgaggatgaaagtcctggacagatctatcaccgagagagaagaaacgcaatcactatg
cagcctcagagtgtgcagggtctcaacaaaatcagtgaggagccctcgacgtctagtgat
gagagggcctcgttgatcaagaaagagatccatggctctctaccacatctggcagagccc
tctctcccttatcgtgggactgtgtttgccatggatccccggaatggctacatggagcct
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattatgatccatctcctattcctccattacatgtgccttct
gccttatctagtagcccaacgtatccagacttgcccttcattaggatctccccacaccgt
aaccccactgcagcctcagaatcccccttcagtcccccacacccctacatcaacccatat
atggactacatccgctcattgcacagcagcccatccctctccatgatctcagctgcccga
gggctgagccctacagatgctccccatgctggagtcagccctgcggaatactatcaccag
atggctctgctgacaggccagcgcagcccttatgcagacatccttccctcagctgccact
gctggtgcaggggccatccatatggagtaccttcatgccatggacagcaccagatttccc
agccctaggctctcagccaggcccagccgaaagcgtacactgtcaatatcgccactctca
gatcatagcttcgaccttcagaccatgataagaacatcccctaactccttggttacaatc
ctcaataattcccgtagcagctcttcagcaagtggttcctacgggcacttatcggcaagt
gcaatcagccctgcgttgagcttcacctacccctctgcccctgtgtctcttcacatgcat
caacagatcctaagccgacagcaaagcttaggctccgcatttggacatagccctcctctc
atccatcctgctccaacatttccaacacagagacctatccctgggattccaacagttctg
aaccccgtccaggtcagctctggcccttctgagtcctcacagagcaagcccacaagcgag
tctgcagtcagcagcactggtgatcctatgcataataagcggtccaagatcaagcctgat
gaagacctccccagcccagggtcacggggccagcaggaacagccggaaggaacaacccta
gtcaaggaggaaggggacaaagatgaaagcaagcaggagcctgaagtcatctacgagaca
aactgccactgggaaggctgcaccagggagttcgacacccaagatcagcttgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagtttgtgtgccgctggcttgactgt
tcaagagagcagaaaccattcaaagcccagtacatgttggtagtgcatatgagaagacac
actggggagaagcctcacaaatgtacatttgaaggttgcacaaaagcctactcaagactc
gaaaacctgaaaacccacttgagatctcacactggagagaagccatacgtctgtgagcat
gagggctgcaacaaggctttctctaatgcttcagatcgggccaagcaccaaaacagaaca
cattccaatgagaaaccgtacgtatgcaaaatccctggctgcaccaagcgttacacagac
cccagctctctccgaaaacacgtgaagactgtgcatggccctgaggctcatgttaccaag
aagcagcgtggggacatgcaccctcggcctccacccccgagagattccggcagccattca
cagtccaggtcccctggccggccaactcagggagcatttggtgagcagaaggagctgagc
accactacctcaaagcgggaagaatgcctccaggtgaagactgtcaaggctgaaaagccc
atggcatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgactgatggaggtagtgtagcagac
ctcagtgccatcgatgaaaccccaatcatggactcgaccatttccacggcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcatatcaaactt
gaaaggctaaaacaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtatctcctctcataggaaatggcacacaatccaataacaactatagttcg
ggtgggcccgggaccctcctcccgagcagaagtgacctgtcaggtgtagacttcacagtg
ctgaacacactcaacaggagagacagcagtaccagcactgtcagctccgcctacctgagc
agccgcagatcctcgggcatctccccctgcttttccagccgcaggtctagcgaggcatcc
caggctgaagggcgaccccagaatgtgagtgtggcggactcctacgatcccatctccaca
gatgcttcaaggaggtccagcgaggccagccagggtgatgggttgcccagtctgctcagc
ctcacgcctgtgcagcagtaccgccttaaggccaagtatgcagctgccactggtggccca
ccacccacacctctgccccacatggaaaggttgagcctgaagaccaagatggccttgcta
ggggaagggagggactcaggggtgaccctgcctccagtccatcctcctcgaagatgcagt
gatgggggaggccacgcctacagagggcgtcacctcatgcatcatgatgcagtagcgaac
agtgtgaggagagccagtgaccctgtgaggacagtctcggagaacatgtcacttcccagg
attcaacgcttcagcagcctcaatagctttaatcctccaaatttgcctccatcggtggaa
aagcgtagcttagtgctgcaaaattatacccggcaggagagcagccaaccccggtacttc
caggcatccccttgccctcccagcatcacagagaatgttgccctggaggctctgaccatg
gatgctgacgctaacttgaatgatgaagatttcctgccagatgacgtggtacagtattta
aattcccagaaccagacagggtatgggcagcagttgcagagtagcatctctgaagatagc
aaagtagcccatgagccagaggacttggacttaccggggctgccagacagtcacattggc
cagcagtacccagctctggagcagccctgctctgagggcagtaaaactgatttgcccatc
cagtggaacgaggtcagttctggaagctctgatctgtcatcctccaagctgaaatgtggt
cagcagcgccctagcgtacagcagcctcggggctttgggctatacaacaatatggtggta
cacccacataatctgtggaaggttggcactggcccagctgggggatatcagaccctcggg
gagaatagcagtgcctacaatggcccagagcactttgcaatccacactggggaaggactt
ggcaccaatggaaatactttccatgaacagccctataagacccagcagtgtgggagccag
ctcaacaggcagccactgacttccagtgctctagaccatgcctgtggtgcagggattcaa
gggtccaagctgaaaggcaacagcttgcaagagaatgggggtttgctagatttcggcctg
tccgtggcaccaaatgagttagctggcaacacagtgaatggcatacaaacccaagatcaa
gtgggacagggatactttgcccatcagctactcagtggtagcgtgcagcaccaggggccc
agccgccctggtcaacaggtactagggcagattggtgctacctcacatatcaacatctat
caagggacagagagctgcctaccagggactcaggacaacagcagccagccatcaagaatg
gcagctatcaggggctaccaaccctgttccagctatgggggtaacaggcgtcaggcaatg
ccaaggggcaacctcactctgcaaccaggacagctcagtgacgtgagtcagagcagcagg
gtgaacagcatcaaaatggaggcacaaggtcagtcccagcagctctgctctaacatgcag
acttattccggtcagttctatgaccaaaccgtgggcttcggtcagcaagacaggaaagct
ggctcgttctccctctcagatgccgactgcctgctccaggggaatggcactgaaaactct
gagctgctttccccaggcgctaaccaggtgacaagcacagttgacagctttgagagtcat
gacctagaaggtgtgcagattgattttgatgccatcatagatgatggggaccataccagc
ctaatgtcaggggccttgagcccaagtatcattcagaacctttcccacagctcctcccgt
ctcaccactccacgggcatccctcccattcccatccctgtccatgggtaccagcaacatg
gctattggggatatgagttctttgctgacttcccttgcagaagaaagcaagttccttgca
gttatgcagtag

DBGET integrated database retrieval system