KEGG   Mus pahari (shrew mouse): 110321573
Entry
110321573         CDS       T05929                                 
Symbol
Mpzl1
Name
(RefSeq) myelin protein zero-like protein 1 isoform X1
  KO
K06770  myelin protein zero
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321573 (Mpzl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110321573 (Mpzl1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  P0
   110321573 (Mpzl1)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 TraL I-set EphA2_TM Adeno_E3_CR2 MDM31_MDM32
Other DBs
NCBI-GeneID: 110321573
NCBI-ProteinID: XP_021053548
Ensembl: MGP_PahariEiJ_G0028044
LinkDB
Position
5:complement(138233604..138275729)
AA seq 270 aa
MAEAVGAVALIAAPARRRWLWSVLAAMLGLLTARISALEVHTPKEIFVVNGTQGKLTCTF
DSPNTTGWLTTVSWSFQPDGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASI
TIENIQAVHNGTYICDVKNPPDIVVRPGHIRLHVVEIDNLLVFLVWVVVGTVTAVVLGLT
LLISLVLVVLYRRKHSKRDYTGCSTSERLSPVKQAPRKCPSDTEGLVKSPPSAGSHQGPV
IYAQLDHSGGHHSGKINKSESVVYADIRKD
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcagaggccgtcggagccgtggcactgattgcggccccggcccgccggcgctggctg
tggtcggtgctagccgcgatgctcgggctgttgacagctagaatatcagccttggaggtc
catactcctaaagaaatctttgtggtgaatgggacgcaagggaagctgacttgcacattc
gattctcctaatacaactggatggctgaccacggtctcctggagcttccagccagacggc
actgacagcgctgtgtcgtttttccactactcacaaggacaggtgtacattggggattat
ccaccatttaaagaccgagtcacctgggctggggaccttgacaagaaagatgcatcgatc
actatagaaaatattcaggctgttcacaatggcacctatatctgcgatgtcaaaaatcct
cctgacattgttgtgcggcctggacacattagactccacgtggtggaaatagacaacttg
ttggtgttcctggtttgggtggtggtgggcactgtcactgctgtggtccttggcctcact
ctgctcatcagcttggtcctggtcgtcctctacagaaggaaacattcgaagcgggattac
accggctgcagtacctcagagcgtttgtcaccagttaagcaggctccacggaagtgtccc
tccgacacagagggtctagtaaagagtccgccttccgccggatctcaccagggcccagtc
atttacgcacagttagaccactctggcggacaccacagtggcaagattaataaatcagag
tcggttgtgtatgcggacatccggaaagactaa

KEGG   Mus pahari (shrew mouse): 110321906
Entry
110321906         CDS       T05929                                 
Symbol
Mpz
Name
(RefSeq) myelin protein P0
  KO
K06770  myelin protein zero
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321906 (Mpz)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110321906 (Mpz)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  P0
   110321906 (Mpz)
SSDB
Motif
Pfam: Myelin-PO_C V-set Ig_2 ig Ig_3 I-set Amnionless Mucin15 SIT Protocadherin Tweety Kinocilin
Other DBs
NCBI-GeneID: 110321906
NCBI-ProteinID: XP_021054160
Ensembl: MGP_PahariEiJ_G0028091
LinkDB
Position
5:143672374..143681793
AA seq 248 aa
MASGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIR
YCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGL
GESRKDKK
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcttctggggctccctcatccagccccagccctatcctggctgccttgctcttctct
tctttggtgctgtctccagccctggccattgtggtttacacggacagggaaatctatggt
gccgtgggctcccaggtgaccctacactgctccttctggtccagtgaatgggtctcagat
gacatctcttttacctggcgctaccagcctgaagggggccgagatgccatttcgatcttc
cactatgccaagggacaaccttacatcgatgaggtggggaccttcaaagagcgcatccag
tgggtaggggaccctcgctggaaggatggctccattgtcatacacaacctagactacagt
gacaacggcactttcacatgtgatgtcaaaaacccaccggacatagtgggcaagacctct
caggtcacgctctatgtctttgaaaaagtgcccactaggtatggggtggtgttgggagct
gtgatcgggggcatcctcggggtggtgttgttgctgctgttgctcttctacctgattcgg
tactgctggctgcgcaggcaggctgcccttcagagaaggctcagtgccatggagaagggg
agatttcacaagtcttcgaaggactcctcgaagcgcgggcggcagacgccagtgctgtat
gccatgctggaccacagccgaagcaccaaagctgccagtgagaagaaatcgaaagggctg
ggggagtctcgcaaggataagaaatag

DBGET integrated database retrieval system