KEGG   Mus pahari (shrew mouse): 110321613
Entry
110321613         CDS       T05929                                 

Gene name
Per2
Definition
(RefSeq) period circadian protein homolog 2 isoform X1
  KO
K02633  period circadian protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04713  Circadian entrainment
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110321613 (Per2)
   04713 Circadian entrainment
    110321613 (Per2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110321613 (Per2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110321613 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110321613 (Per2)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110321613 (Per2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 110321613
NCBI-ProteinID: XP_021053617
Ensembl: MGP_PahariEiJ_G0027660
LinkDB
Position
5
AA seq 1257 aa
MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDSGK
ELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLRELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTMEQVEGIT
SEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQ
GAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESRRRRSGIFKTSGKIQTKSHVSHESGGQKEVSVA
EMQSSPPAQVKAVTTIERDSSGASLPKANFPEELTYKNQPPCSYQQISCLDSVIRYLESC
SEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDVASGPESLDGAAGGLSQEKGPLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGIESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLLGLNATAWSPSDTSQSSCPSAPFPAAVP
AYPLPVFQAPGIVSTPGTVVAPPAAAHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYSFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSSLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGT
SRDRQPKAPPTCNEPSDTQNSDAISTSSDLINLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGCDTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMITDTEESEQFIKYVLQDPIWL
LMANTDDSIMMTYQLPSRDLQTVLKEDQEKLKLLQRSQPRFTEGQRRELQEVHPWVHTGG
LPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTSPRKEAQT
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgaatggatacgtggacttctccccaagtcccaccagccccaccaaggagccaggggca
ccccagcccacccaggctgtgctccaggaagacgtggacatgagcagcggctccagcgga
aacgagaactgctccacggggcgggactctcagggcagtgactgcgacgacagtgggaag
gagctgcgaatgctagtggaatcttccaacactcaccccagccctgatgatgccttcaga
ctcatgatgacagaggcagagcacaacccgtccacgagtggctgcagtagtgagcagtct
gccaaagctgatgcacacaaagaactgataaggaccctgagggaactgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacactggcaaccctgaagtatgccctg
cggagtgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagtgtggatgtgccttcctacaccatggagcaggttgagggcattacc
tccgagtatatcgtgaagaacgcggatatgtttgctgtggctgtgtccctggtttctggg
aagatcctgtacatctctaaccaagtggcctccatctttcactgcaagaaggacgccttc
agtgacgccaagtttgtggagttcctggctcctcatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgtgcagtggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagcag
ggtgctgagagccagctctgctgcctgctgctggcagagagggtacactcaggctatgaa
gctcctagaattcctcctgagaagagaattttcacaacgacccacacaccaaactgcttg
ttccaggatgtggatgaaagggcagtccccctcctgggctatctacctcaggatctgatc
gagacccctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccggtgggcagcctttcgattattctcccattcgattccgcacc
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccatggagc
aggaagatatctttcatcatcgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccgtgcccagaggagaagactccgcaccccagcgttcaggagctc
acagagcaaatccaccgtctgctgatgcagcctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaacggtcaggaggagtctcgccggaggagatccggaatttttaaaaccagtggcaag
attcaaaccaaaagtcacgtctctcatgagtctggaggacagaaggaagtgtctgttgca
gaaatgcaaagcagccccccagctcaggtgaaagctgtcaccaccatagaaagggacagc
tcaggggccagcctacccaaggccaacttcccagaggaactaacctataagaaccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
agtgaggcagccaccctgaaaaggaagtgcgagttcccagccaatatcccatcccggaag
gccacagtcagcccggggctgcactctggagaggcggcgcggccttccaaggtgaccagc
cacacagaagtcagtgctcatctgagctccctgacactgccaggcaaggctgagagtgtg
gtgtccctcaccagccagtgcagctacagtagcaccatcgtgcacgtgggcgacaaaaag
ccacagcccgagctagagacagtagaagatgtggccagtgggcccgagtccctggatggt
gcagccggcggcctcagccaagaaaaggggcctcttcagaagctgggcctcaccaaggaa
gttctggctgcacatacgcagagagaggagcagggcttcctgcagaggttcagggaagtg
agcaggctcagtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
caggcgagtgatcgaggactaagaaatacttctggaatagagtcatcttggaaaaaaact
ggaaagaacaggaaactgaagtccaagcgcgtcaagactcgggactcttctgagagcaca
gggtctggaggaccggtgtcccaccgacctcccctcctgggcctgaatgccacagcctgg
tcaccctccgacacatcccagtccagctgcccctccgcacccttccctgccgcagtgcca
gcttaccccctacctgtgttccaggcacccggaatagtatccacaccggggacagtggtg
gcgccacctgcagccgcccacaccggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccgttcgctgcccccttggctcctgtcatggccttc
atgctgcccagctactcgttcccaccagcaaccccaaacctgcctcaggccttcctcccc
agccagcctcactttccagcccaccccacgcttgcctctgaaataactccagcctcccag
gctgagttccctagtcggacctcgtcgctcagacagccgtgcgcttgcccggtcacccct
ccggccggcacagtggccctgggcagggcctccccaccgctcttccagtcccgaggcagc
agtcccctgcagcttaacctgcttcagctagaggaggcgcctgaaggcagcactggggcc
gcagggaccctggggaccacagggacagcagcttctggtctggactgcacatctggcaca
tctcgggatcggcagccaaaggcacctccaacatgcaacgagccctcagacacccagaat
agcgatgccatctccacgtcaagtgacctgatcaacctcctcctgggcgaggacctctgc
tcagccaccggctcagccctgtctagaagcggggcgtccgccacctcagactctctgggc
tccagctcgctgggctgcgacacatcccaaagtggggcaggcagtagtgacacgagtcac
accagcaaatactttggaagcattgactcttcggagaataatcacaaagcaaaaatgatc
acagacacggaggaaagtgaacagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacagcatcatgatgacataccagctgccttcccgggatctc
cagacggtgttgaaggaggaccaggagaagctgaaactgctgcagaggtcccagccccgg
ttcacagagggccagaggcgagagctacaagaggttcatccgtgggtccacactgggggc
ctgcccacagccattgacgtgacgggctgtgtttactgcgagagtgaggagaaaggcaac
atttgtctgccatatgaggaagacagtccttctccgggactctgtgatacctcagaagcc
aaagaggaggaaggcgaacagctgacaagccccaggaaagaggcccagacgtaa

KEGG   Mus pahari (shrew mouse): 110322954
Entry
110322954         CDS       T05929                                 

Gene name
Per3
Definition
(RefSeq) period circadian protein homolog 3 isoform X1
  KO
K21945  period circadian protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110322954 (Per3)
   04713 Circadian entrainment
    110322954 (Per3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110322954 (Per3)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110322954 (Per3)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS DNA_Packaging
Other DBs
NCBI-GeneID: 110322954
NCBI-ProteinID: XP_021055587
Ensembl: MGP_PahariEiJ_G0029185
LinkDB
Position
6
AA seq 1104 aa
MDPCGDPAVPGGDCLQTRGAGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEDLLMVVQE
MKKYFPAERHTKPTTLDALNYALRCVHSVQANSEFFQSLSPHGARQADVTVYSLEDLTSL
ASEHTSKNTDTFVAVFSFLSGRLVHISEQAALVLNSKKGFLKSLHFVDLLAPQDVRVFYA
HTAPTQLPFWNNWTQRDSQYECAPVKPFFCRICGGGDREQKRHYSPFRILPYLVHVHSSA
QPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLI
GTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGDYVILDSSWSSFVNPW
SRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHANASSGY
GSLGSSGSQEQHISITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIETMAR
SSVKPVTETCVELQGGDEQKDFSSSQTLKNKSTTDTGSGGDLRQEQDSSSYQQMNCIDSV
IRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEADSSQRDTEQLLDIPKQETTEPSTDV
EGGVAQTLSTATLSVVSGISQCSCSSITDHAPPLQSAESVAVACKPWALRTKASHLSAGR
FKHVGLTAAVLSEHTQKEEQNYVDRFREKILTSPYGCYLQQESRNHAQCSCAQAGSTSQH
SRCAGSERRKHKRKKLPAPVDTSSSGAHLCPHVRGLLPDEQHWSLSASPSPVGAGLAFPS
QTPYLLPSFPLQDMASQGVGDSGAWGAAAGCPPLSTGPQSVSAFPSAYLDTLMTIFLHNT
PLFPLWPPSFSPYPFLGAAGSSELAPNLEPTTSDHSQRREEENWETHSEELPFFSSRSSS
PLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGNRSRHCASGELATATAQQESP
SAAASESSTSSINFSSSDYASEGSENSQRPQDRQRDEALPGTAEESIWRMIARTPECVLM
TYQVPERGRDEVLKQDLEKLHRMEQQQPLFSPAQREELAKVRSWIHSHTAPQERCLQSCV
ACEDRGSVGDTTEVLEQHPAEDTS
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggatccctgtggagacccggcagtgcctggtggcgactgtctccagactaggggagcg
gggctccagggggcgtctggccaggagggtcctctgcagggcacttgcgtggacagcagc
cacagtgaacacgaagaccgaaacagaatgtctgaagaccttttaatggttgtccaagaa
atgaaaaagtatttcccagccgagaggcacactaagcccaccaccctagatgctcttaac
tatgccctgcgctgtgtacatagtgtgcaagcaaacagtgaatttttccagagtctcagt
ccacacggagcacgccaggcagatgtgactgtatacagtcttgaggacctgacctctctg
gcttctgaacatacttccaagaacacagacacctttgtggccgtgttttcgtttctgtct
ggaaggttagtgcacatttctgagcaggctgctttggtcctgaattctaagaaaggtttc
ctcaagagcttgcactttgtcgacctgcttgcccctcaagacgtgagggtgttctacgcg
cacactgctccaactcagcttcctttctggaacaactggacccaaagagactcgcagtat
gaatgtgcaccagtgaaacccttcttctgcagaatctgtggaggtggagacagagagcag
aagaggcattactccccattccggatcctcccctatttggttcatgtacatagctctgcc
cagccggaaccagagccttgctgtctaacactggttgaaaagattcactctggttacgaa
gctcctcgaatccctgtagataaaagaatttttaccacaacacacactccaggatgtgtg
tttcttgaagtagatgaaagagcagtgcctttgctgggttacctacctcaggatctgatt
ggaacatcgatcttaacatacttgcacccagaagatcggcctctgatggttgccatacac
caaaaagttttaaagtatgcgggccaccctccgtttgaacactcgcccgtcagattctgc
actcagaatggagattatgtcattctggattccagctggtccagctttgtgaacccctgg
agccggaaggtctccttcatcattggtcgacataaagtccgaacgagtccattaaatgaa
gatgtttttgccaccagaataaaaaaggcagccagtaacgacaaagacatagcagaatta
caagaacaaattcacaaacttctcttgcagccggttcatgctaatgcttccagtggctac
gggagcctgggcagcagcggctcacaggagcagcacatcagcatcacctcttcgagtgag
tcaagcggacactgtccggaggaaggccagcatgagcagatgaccctgcagcaggtctat
gccagtgtaaacaaaattaagaatgtgggccaacagctctacatcgagacgatggccaga
tcatcagtaaagcccgtgacagagacatgcgtggaactgcagggtggtgatgagcagaag
gacttttcttcctctcagactctgaaaaataaaagcaccacagataccggctccggtggc
gatctgcggcaagagcaggacagctcgtcctatcagcagatgaactgtatcgacagtgtc
atcaggtacctgacaagctacagcctcccagccttgaaaagaaagtgcatctcctgcaca
aacacgtcttcatcctcagaagaagccaagccaatcccagaggcggacagcagccagcga
gacactgaacagctcctagacatacctaaacaggaaacaactgaaccatccacagacgtc
gaaggaggtgttgcacagaccctgtccaccgccacactgagcgtggtgtccggcatcagc
cagtgcagctgcagcagcatcactgaccatgctccgcctctgcagtcagcagaaagcgtt
gccgtggcgtgtaagccgtgggccctgagaacaaaggcctctcacctgtctgcaggaaga
tttaagcacgtggggctcacagcggctgtcctctccgaacacacacagaaggaagagcag
aactatgttgacaggtttcgggaaaagatcctgacctcgccctacggttgctatcttcag
caagagagcagaaaccatgctcagtgctcctgtgctcaagcagggtccacctctcagcac
agcagatgtgctggaagtgagagacggaagcacaaacggaagaagttgccagcacctgta
gacaccagcagctccggtgcccacctctgtccccatgtcagaggactccttccagatgag
cagcactggagcctgtccgctagcccctcccccgttggtgcaggcttagctttccccagc
cagaccccttatctcctcccctcttttcccctccaagatatggcctctcagggagtaggg
gactcgggagcctggggagctgcagctggctgtccacctctgtccactggcccccagtct
gtttccgcattcccctctgcttacttggatactttgatgaccatcttcctgcacaacacc
cctctcttccctctgtggccaccatcgttctctccgtacccgttcctgggggccgcaggt
tcttctgaactggctccaaacctggaaccaaccacttcagaccacagccagaggagagag
gaggagaactgggagacacacagtgaagagcttccgttctttagctcacggagcagttca
ccactgcagttaaatttactccaggaagaaatgcctgcaccgtcagagtccgcagatgca
gtgaggagaggcgctgggccagatgctaagcatcactgtgttacaggtcccagtggcaat
aggagccgtcactgtgcctctggtgagctggccacggcaaccgcgcagcaggagtctccg
tctgcagctgcctcagaaagcagtaccagcagtataaacttcagtagcagtgactacgct
tctgaaggctctgaaaacagtcagaggccacaggatagacagagagacgaagcccttccc
gggacggctgaagagtccatctggagaatgatagcgcggacgccagagtgtgttctcatg
acgtaccaggtgcccgagaggggtcgagacgaggtgctgaagcaggacctggaaaagctt
caccgcatggagcagcagcagcccctgttctctcctgcgcagagggaggagctggccaaa
gtgcgctcctggatccacagccacactgcccctcaggaaagatgcctccagagctgtgtt
gcctgtgaagacagaggttcagtgggtgacactacagaggtccttgaacagcacccagca
gaagacaccagttga

KEGG   Mus pahari (shrew mouse): 110331650
Entry
110331650         CDS       T05929                                 

Gene name
Per1
Definition
(RefSeq) period circadian protein homolog 1 isoform X1
  KO
K21944  period circadian protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110331650 (Per1)
   04713 Circadian entrainment
    110331650 (Per1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110331650 (Per1)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110331650 (Per1)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 110331650
NCBI-ProteinID: XP_021068088
Ensembl: MGP_PahariEiJ_G0017685
LinkDB
Position
14
AA seq 1292 aa
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLQDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDSDIQELSEQIHRLLLQPVHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PVPDQASLALAPEEPERKEASGCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTAS
SASDDDKQRTGPVPVGAKKDPSSAVLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPTPDAYRPVGLTK
AVLSLHTQKEEQAFLNRFRDLGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSR
HHQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPT
SVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPASHSPSPSLPPPPP
SPPHRPDSPLFNSRCSSPLQLNLLQLEEPPRTEGGAATGGPGSSAGPLPPSEETAEPEAR
LVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSA
SITRSSQSSHTSKYFGSIDSSEAEAGAAQARAEPGDQVIKYVLQDPIWLLMANADQHVMM
TYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVTACV
DCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGGGGGSGGGGGRDGGEEAQTQVGA
KGSSSQDSAMEEEEQGGSSSSPALPAEENGAS
NT seq 3879 nt   +upstreamnt  +downstreamnt
atgagtggtcccctagaaggggccgatgggggaggagaccccaggcccggagaacctttt
tgtcctggaggagtcccatcccctggggccccgcagcaccggccttgcccaggccccagc
ctggctgatgacactgatgcaaacagcaatggctcaagtggcaatgaatccaatggacac
gagtccaggggtgcatctcagcggagttctcatagctcctcttctggcaatggcaaggac
tcagctctgctggagaccactgagagcagcaagagtacaaactcacagagcccatcccca
cccagcagctccattgcctacagcctcctgagtgcgagctcagagcaggacaacccatct
accagtggctgcagcagtgaacagtcagctcgagccaggacccagaaagaactcatgacc
gcacttcgggagctcaaacttcggctgccaccagagcgtcggggcaagggtcgctctggg
accctggccactctgcagtacgcgctggcctgtgtcaagcaggtgcaggctaaccaggaa
tattaccagcagtggagtctggaggagggtgagccttgtgccatggacatgtctacttac
accctggaggagttggagcatatcacatccgaatacacacttcgaaaccaggacaccttc
tctgtggctgtgtccttcctgacaggccggattgtgtatatttcggagcaggcaggtgtc
ctgttgcgctgcaaacgggatgtgtttcggggtgcccgcttctcagagctcctggctccc
caggatgtgggtgtcttctatggctctaccacaccatctcgactgcccacctggggcact
ggcacctctgcaggttcaggcctccaggacttcacccaagagaagtccgtcttctgccga
atcagaggaggtcctgaccgggatccagggccccggtaccagccattccgcctaacccca
tatgtgaccaagattcgggtctcagatggggcccctgcacagccgtgctgcctactcatt
gcagagcgcatccactctggttatgaagctccccggatccctcctgacaagaggatcttc
accacacgacacacaccaagctgcctcttccaggatgtagatgaaagggctgccccactg
ctgggttaccttccccaggatctcctgggggctccggtacttctctttctacatcctgag
gaccgacccctcatgctggccattcataagaagatactgcagctggcaggccagcccttt
gaccattcccctattcgcttctgtgctcggaacggggaatatgtcaccatggacaccagc
tgggccggctttgtgcacccctggagccgcaaggtggctttcgtgttgggccgccataaa
gtgcgcacggcacccctgaatgaggacgtgttcactcccccagcccccagcccggctccg
tccctggactctgatatccaggagctctcagagcagatccatcgattgctgctgcagcct
gtgcacagctccagccccacagggctctgtggagttggccctctgatgtcccctggtcct
ctacacagccctggctcctccagtgatagcaatggcggtgacgctgaggggcccgggcct
cctgctccagtgactttccagcagatctgtaaggacgtgcacctggtaaagcaccaggga
caacagctcttcattgagtctcgggccaagcctccaccccggccccgcctccttgctaca
ggtacattcaaagccaaagtcctcccctgccagtccccaaaccccgaactggaggtggcc
cctgttcctgaccaagcctcattagcattggcccctgaggagccagagaggaaggaagcc
tctggctgttcctaccagcagatcaactgcctggacagcatcctcaggtatttggagagc
tgcaacatccccagtacaaccaagcgtaaatgtgcctcctcctcctcctacactgcctct
tcggcctctgacgacgacaagcagaggacgggtccagttcctgtgggggccaagaaagat
ccgtcgtcagcagtgctgtctggggagggggcaactcctcggaaggagccagtggtggga
ggcaccctgagcccgctcgccctggccaataaggcagagagcgtggtgtccgtcaccagt
cagtgtagcttcagctctaccatcgtccatgtgggagacaagaagcccccggagtcggac
atcatcatgatggaagacctgcctggcctggcccctggcccagcccccagtccggccccc
agccccacagtagcccctgacccaaccccagatgcttatcgcccagtgggtctgaccaag
gccgtgctgtccctgcacacacagaaggaagagcaagccttcctcaaccgcttcagagat
cttggcaggcttcgtggacttgacacctcttctgtggccccctcagcccctggctgccac
catggccccattccccctggtcgccgacaccactgccgatctaaagcaaagcgttcccgc
caccaccagaccccccggcctgaaactccctgctatgtctcccatccttcacctgtgccc
tcttctggaccctggccacccccaccagccactacccccttcccagcagtggtccagccc
tacccactcccagtattctcccctcgaggaggaccccagccgcttccccctgcccctaca
tctgtgtcccctgctaccttcccttctcctttagtgaccccaatggtggccttggtgctc
cctaactatctattccctaccccacctagttatccatatggggtgtcccaggcccctgtt
gagggaccacccacgcctgcttcccactcgccctctccatcactgcccccaccacctccc
agccccccccaccgcccagactccccactgttcaactcaagatgcagctccccactccag
cttaatctgctgcagcttgaggagcccccccgcacggaggggggtgctgccacaggaggc
cccggaagcagtgccgggcccctgcctcccagtgaggagactgctgagccagaggccaga
ttggtggaggttaccgagtcgtccaatcaggatgcactttcaggctccagcgacctgctg
gagctactgctacaagaagactctcgctcgggcacaggctccgcagcctcaggctccctg
ggctctggcctgggctctgggtctggttcgggatcccacgaagggggaagcacctcagcc
agcatcacccgcagcagtcagagcagccatacaagcaaatacttcggcagcatcgactct
tcggaggctgaagctggggctgctcaggccagggctgagcctggggaccaggtgattaag
tatgtgctccaggaccccatctggctgctcatggccaacgctgaccagcacgtcatgatg
acataccaggtgccgtccagggatgcagcctctgtgctgaagcaagaccgggagaggctc
cgggccatgcagaaacagcagccacggttctcagaggaccagaggcgggaactgggtgct
gtgcactcctgggtccggaaaggccagctgcctcgggcccttgatgtgacggcttgtgtg
gactgcggtagcagcgttcaagatcctggccactctgatgacccactcttctctgaactg
gatggattagggctggagcccatggaagagggtggaggcgagggtggagggggtggtggt
ggcagcggtgggggtggtgggcgtgatggtggtgaggaggcccagacccaggttggggct
aagggttcaagctctcaggactctgccatggaggaagaagagcaaggtgggagctcatcc
agtccagctttacctgcagaagaaaatggcgccagctag

DBGET integrated database retrieval system