KEGG   Mus pahari (shrew mouse): 110321621
Entry
110321621         CDS       T05929                                 
Symbol
Cr1l
Name
(RefSeq) complement component receptor 1-like protein isoform X1
  KO
K04011  complement component (3b/4b) receptor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04613  Neutrophil extracellular trap formation
mpah04640  Hematopoietic cell lineage
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05144  Malaria
mpah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110321621 (Cr1l)
   04610 Complement and coagulation cascades
    110321621 (Cr1l)
   04613 Neutrophil extracellular trap formation
    110321621 (Cr1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110321621 (Cr1l)
   05152 Tuberculosis
    110321621 (Cr1l)
  09174 Infectious disease: parasitic
   05144 Malaria
    110321621 (Cr1l)
   05140 Leishmaniasis
    110321621 (Cr1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110321621 (Cr1l)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110321621 (Cr1l)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110321621 (Cr1l)
CD molecules [BR:mpah04090]
 Proteins
  110321621 (Cr1l)
SSDB
Motif
Pfam: Sushi PspB DUF543 Orf78
Other DBs
NCBI-GeneID: 110321621
NCBI-ProteinID: XP_021053632
Ensembl: MGP_PahariEiJ_G0028307
LinkDB
Position
5:complement(166890720..166921924)
AA seq 439 aa
MESSSRSSEPKDPAWRIVAFGRGGVQLAVLLLFLLPSTLGQCPAPSQLPSAKPLNLTDES
MFPFGTFLKYECRPGYIKRQFSIICQEDSTWTSAEDKCIRKQCRTPLDPQNGLVHVHTGI
QFGSRINYTCNKGYRLIGSSSAVCIITDQSVDWDTEAPVCEQIPCEIPPGIPNGDFFSSN
REDFHYGMVVTYRCNTDGRGKELFYLVGEPSLHCTSNDDQIGVWSGPPPQCIELNKCTPP
YVENAVIVSENKSLFSLRDIVEFKCQPGFIMKGDSSVHCQSVNKWEPELPSCFKGVTCHL
PRDMSGFQKGLEMKKEYYYGDNVTLECEDGYTLEGSSQSQCQSDGSWDPLLAKCVSRSIS
GLIVGIFIGIIVFILFIIVFFWVILKYKKRNTTDEKCKEVGIHLNSKEDSCVRLQSLLTS
QENSSTTSPARNSVTQEIS
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggagtcctcctctcggagttcagagcctaaagatccggcgtggcgcattgtagccttc
ggccggggaggagtccagctggcggtcttgctgctgttcttgctgccatcaactttgggt
cagtgcccagccccatcacagcttccttctgccaaacctctaaatctaactgatgaatcc
atgtttccctttggaacatttttgaagtatgaatgtcgcccaggatatatcaagaggcag
ttctctatcatatgccaagaagactcaacctggacaagtgctgaagataagtgtatacgt
aaacaatgtagaactcctttagatcctcagaatggcttggtacatgtacacacaggcatt
cagtttggatcccgtattaattatacttgtaataaaggataccgcctcattggttcctct
tctgctgtatgtatcatcactgatcaaagtgtagattgggatactgaggcacctgtttgt
gagcagattccttgtgagatacccccaggcattcccaatggagatttcttcagttcaaac
agagaagactttcattatggaatggtggttacctaccgctgcaatactgatgggagaggg
aaggagctcttttacctggtgggtgagccctccttacactgtaccagcaacgatgatcaa
attggagtctggagtggccctccgcctcagtgcattgaactcaacaaatgtactcctccc
tatgttgaaaatgcagtcatagtgtctgagaacaaaagcttgttttccttaagggatatt
gtggagtttaaatgtcagcctggctttatcatgaaaggagacagcagtgtgcattgtcag
tccgtaaacaaatgggagccagagttaccaagctgcttcaagggagtgacgtgtcatctc
cctcgggatatgagtggattccagaagggattggaaatgaaaaaagaatattactatgga
gataatgtaaccttggaatgtgaggatgggtatactctagaaggcagttctcagagccag
tgccagtctgatggcagctgggatcctcttctggccaaatgtgtatctcgctcaatcagt
ggtctaatagttggaattttcattgggataatcgtctttattttattcatcattgttttc
ttttgggtgattctgaagtataaaaaacgcaataccacagatgagaagtgtaaagaagtg
ggtattcatttaaattctaaagaagacagctgtgttcgccttcagtctctgctcacaagt
caggagaacagcagcaccactagcccagcacggaattcagtcactcaagaaatctcctaa

DBGET integrated database retrieval system