KEGG   Mus pahari (shrew mouse): 110321750
Entry
110321750         CDS       T05929                                 
Symbol
Cd34
Name
(RefSeq) hematopoietic progenitor cell antigen CD34
  KO
K06474  CD34 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321750 (Cd34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110321750 (Cd34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110321750 (Cd34)
CD molecules [BR:mpah04090]
 Proteins
  110321750 (Cd34)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 110321750
NCBI-ProteinID: XP_021053868
Ensembl: MGP_PahariEiJ_G0028305
LinkDB
Position
5:166745862..166768710
AA seq 382 aa
MQVHRDARAGLLLPWGWVALCLMSLLHLNNLTSVATETSTQGISPSVPTNESIEENITSS
IPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTLSQPQTSSTVILPTTSD
SVSTSEMTWKSRLPSINVSDYSPTNISFEITSPTEPYAYISSSAPSAIKGEIKCSGIREV
RLAQGICLELSEASSCEQFKKEKGEDLIQILCGKEESDADPGASICSLLLAQSEVRPECL
LMVLANSTELPSKLQLMGKHQSDLRKLGIQNFNKQDIGSHQSYSRKTLIALVTSGVLLAI
LGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENG
TGQATSRNGHSARQHVVADTEL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcaggtccacagggacgcgcgcgcggggctcctgctgccatggggctgggtagctctc
tgcctgatgagtctgctgcatttaaataacttgacttctgttgccacggagacttctacc
caaggaatatcaccatcagttcctacaaatgagtccattgaggaaaatatcacatctagc
atccctggaagtaccagccactacttgatctatcaggacagtagtaagaccacaccagcc
atctcagagactatggtcaactttacagttacctctgggatcccttcaggctctggaact
ccacacactctttcacaaccacagacttcctcaactgtcatactgcctactacttcagac
agtgtttccacttcagagatgacctggaagtccagactaccatctataaatgtttctgat
tattcgcctactaatatcagctttgagataacatcacccactgagccatatgcttacata
tcatcttctgctccgagtgccattaagggagaaatcaaatgttcaggaatccgagaagtg
aggttggctcagggtatctgcctggaactaagtgaagcatctagctgtgagcagtttaag
aaggaaaagggagaagatctaattcaaattctgtgtggaaaggaggagtctgatgctgat
cctggtgctagtatctgctccctgcttctagcccagtctgaggttaggcctgagtgtttg
ctgatggtcttggccaatagcacagaacttcccagcaaactccagcttatgggaaagcac
cagtctgacttgagaaagctgggaatccaaaacttcaataaacaagatattgggagccac
cagagctattcccgaaagactcttattgcattggtcacctcaggagtcctgctggctatc
ttgggcaccactggttatttcctgatgaaccgtcgcagttggagccctacaggagaaagg
ctgggtgaagacccttattacacggagaatggtggaggccagggctatagctcaggacct
ggggcctcccctgagactcagggaaaggccaatgtgacccgaggggctcaggagaacggg
accggccaggccacttccagaaacggccattcagcaagacaacatgtggtggctgacaca
gaactgtga

DBGET integrated database retrieval system