KEGG   Mus pahari (shrew mouse): 110321797
Entry
110321797         CDS       T05929                                 

Symbol
Cxcr4
Name
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04062  Chemokine signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04670  Leukocyte transendothelial migration
mpah04672  Intestinal immune network for IgA production
mpah04810  Regulation of actin cytoskeleton
mpah05163  Human cytomegalovirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110321797 (Cxcr4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110321797 (Cxcr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110321797 (Cxcr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110321797 (Cxcr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110321797 (Cxcr4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110321797 (Cxcr4)
   04672 Intestinal immune network for IgA production
    110321797 (Cxcr4)
   04062 Chemokine signaling pathway
    110321797 (Cxcr4)
  09158 Development and regeneration
   04360 Axon guidance
    110321797 (Cxcr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321797 (Cxcr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110321797 (Cxcr4)
   05163 Human cytomegalovirus infection
    110321797 (Cxcr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110321797 (Cxcr4)
   04050 Cytokine receptors [BR:mpah04050]
    110321797 (Cxcr4)
   04090 CD molecules [BR:mpah04090]
    110321797 (Cxcr4)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    110321797 (Cxcr4)
Cytokine receptors [BR:mpah04050]
 Chemokine receptors
  CXC Chemokine
   110321797 (Cxcr4)
CD molecules [BR:mpah04090]
 Proteins
  110321797 (Cxcr4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros MFS_1
Other DBs
NCBI-GeneID: 110321797
NCBI-ProteinID: XP_021053957
Ensembl: MGP_PahariEiJ_G0027784
LinkDB
Position
5
AA seq 359 aa
MDPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGL
VILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTV
NLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVS
QGDISQGDDRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQ
KRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQGCDFESIVHKWISITEALAFF
HCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggacccgatcagcgtgagtatatacacttccgataactactccgaagaagtggggtct
ggagactatgactccaacaaggaaccctgcttccgggatgagaacgtccatttcaataga
atcttcctgcccaccatctacttcatcatcttcttgactggcatagtgggcaatggattg
gtgatcctggtcatgggttaccagaagaagctaaggagcatgacggacaagtaccggctg
cacctgtcagtggctgacctcctctttgtcatcacgctccccttctgggcagttgatgcc
atggctgactggtactttgggaaatttttatgtaaggctgtccatatcatttacactgtc
aacctctacagcagcgtcctcatcctggccttcatcagcctggaccggtacctcgccatc
gtccacgccaccaacagtcagaggccgaggaagctgctggctgaaaaggcagtctatgtg
ggtgtctggatcccagccctcctcctgacaatacctgacttcatctttgccgacgtcagc
cagggggacatcagtcagggggacgacaggtacatctgtgatcgcctttaccccgacagc
ctgtggatggtggtgttccagttccagcacatcatggtgggtctcatcctgccaggcatc
gtcatcctctcctgttactgcatcatcatctctaagctgtcacactccaagggccaccag
aagcgcaaggccctcaagacaacagtcatcctcatcctggctttttttgcctgctggcta
ccatattacgtgggaatcagcattgactccttcatccttttgggggttatcaagcaagga
tgtgacttcgagagcatcgtgcacaagtggatctccatcacggaggccctcgctttcttc
cactgttgcctgaacccgatcctctatgccttcctcggggccaagttcaaaagctctgcg
cagcatgcactcaactccatgagcagaggctccagcctcaagatcctttccaaaggaaag
cggggtgggcactcttctgtctccacagagtcagaatcctccagctttcactccagctaa

DBGET integrated database retrieval system