KEGG   Mus pahari (shrew mouse): 110321849
Entry
110321849         CDS       T05929                                 

Gene name
Disp1
Definition
(RefSeq) protein dispatched homolog 1 isoform X1
  KO
K24680  protein dispatched 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110321849 (Disp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110321849 (Disp1)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   110321849 (Disp1)
SSDB
Motif
Pfam: Patched MMPL Sterol-sensing
Other DBs
NCBI-GeneID: 110321849
NCBI-ProteinID: XP_021054054
Ensembl: MGP_PahariEiJ_G0028239
LinkDB
Position
5
AA seq 1527 aa
MRTKTSGMAVISGSDSVLLSNGSISTSTSNPNPLSPSDGDLPAQQLGPRETPRTKASPNG
CLQLNGTVKSSFLPLDNQRTPQTPAQCCHPCPYHHPVSGHSSHQECHPEAGLAASPALAS
CRMQPHSEYSASLCPNHSPVYQAAHCLQPSPSFCLHHPWPDHFQHQPVRQHLTIIRPSRP
FKFPRSYAALLADWPVVVLGMCTLLIVVCALVGVLVPELPDFSDPLLGFEPRGTTIGQRL
VTWNNMMRNTGYKATLANYPYKYAEEQARSHRDDRWSDDHHERERREVDWNFQKDSFFCD
VPSDGYSRVVFASAGGETLWNLPAIKSMCDVDNSRIRSHPQFSDLCQRTTAVSCCPSWTL
GNYIAILNNRSSCQKIVERDVSHTLKLLRTCAKHYQNGTLGPDCWDKAARRKDQLKCTNV
PRKCTKYNAVYQILHYLVDKDFMTPKTADYAVPALKYSMLFSPTEKGESMMNIYLDNFEN
WNSSDGITTVTGIEFGIKHSLFQDYLLMDTVYPAIAIAIVLLIMCVYTKSMFITLMTMFA
IISSLIVSYFLYRVVFNFEFFPFMNLTALIILVGIGADDAFVLCDVWNYTKFDKPRAETS
EAVSVTLQHAALSMFVTSFTTAAAFYANYVSNITAIRCFGVYAGTAILVNYVLMVTWLPA
VIVLHERYLLNVFTCFRKPQPQAYHKSCWAVLCQKCRRVLFAVSEASRIFFEKVLPCIVI
KFRYLWLIWFLALTVGGAYIVCVNPKMKLPSLELSEFQVFRSSHPFERYDAEFKKLFMFE
RVHHGEELHMPITVIWGVSPEDSGDPLNPKSKGELTLDSTFNIASPASQAWILHFCQKLR
NQTFFHQTEQQDFTSCFIETFKQWMENQDCDEPALYPCCSHCSFPYKQEVFELCIKKAIM
ELDRSTGYHLNNKTPGPRFDINDTIRAVVLEFQSTFLFTLAYEKMQQFYKEVDSWISHEL
SSAPEGLSRGWFVSNLEFYDLQDSLSDGTLIAMGLSVAVAFSVMLLTTWNIIISLYAIVS
IAGTIFVTVGSLVLLGWELNVLESVTISVAVGLSVDFAVHYGVAYRLAPDPDREGKVIFS
LSRMGSAIAMAALTTFVAGAMMMPSTVLAYTQLGTFMMLVMCVSWAFATFFFQCLCRCLG
PQGTCGQIPFPTKLQCSAFSHTLSARPGDRGPSKTHAASAYSVDARGQKSQLEHEFYELQ
PLASHSCTSSEKTTYEEPHTCSEFFNGQAKNLRMPVPAAYSSELTKSPNSEPGSALLQPC
LEQDTVCHFSLNPRCNCPDAYTHLKYGLPEIHCQQMGDSLCHKCASTAGGFVQIQNAVAP
LKASHRAAEGLLHPAQHMLPPGMQSSRPRNFFLHPVQHFQAQENLGHTSTHSTDEHLPRT
EPPPPPSDSRSTESFQRACCDPKTNQRRLCKSRDTGDTEGSGGTETKVSSLPNQTDKEEK
QEEPSLLQTGDTVHSEHLNRNESNFTFSHVPGEAGCRSCPNSPQSSRSIVRLKCGSADCQ
TPNLEANVPAVPTHSDLSGESLLIKTL
NT seq 4584 nt   +upstreamnt  +downstreamnt
atgaggaccaaaacatcgggcatggctgtgattagcggaagtgactctgtgcttctgagc
aacggcagcatctcaaccagcacctccaaccctaatcccctcagccccagtgatggagac
ctcccagcccagcagctcggacccagagaaaccccgagaacaaaagcaagcccaaatgga
tgcctgcaacttaatggcacagttaagtcatcctttctgcctttagacaaccaaagaaca
cctcagacgccagctcagtgctgccacccttgtccataccatcaccctgtgagcggccac
agcagtcaccaagagtgccaccccgaggctggccttgcagcctcccccgctttggcctcg
tgtcgcatgcagccacattccgaatactctgcatctctgtgtccaaaccattcacccgtg
tatcaggctgcgcactgccttcagccctcaccatctttctgccttcatcacccgtggcct
gaccatttccagcatcaacctgtacggcagcacctgaccatcatcaggccgtccagacct
ttcaagttcccaagaagttacgcagccctgctggctgactggcctgtggtggtcctgggc
atgtgcacgctgctcatcgtggtctgtgccctggtgggggtcctagtgccggagctccct
gacttctcggacccgctgctgggttttgagccaagagggaccacgataggacagaggctg
gtcacgtggaataacatgatgcgaaacacaggttacaaagcaacattggccaactatcct
tataagtatgcagaggagcaagccagaagccaccgggatgacaggtggtcagatgatcat
catgagagagagagaagggaagtagactggaacttccagaaagacagcttcttctgcgat
gttccaagtgacggatactccagagtagtgtttgcttcggcaggaggggagactctgtgg
aatttacctgcaattaagtcaatgtgtgatgtggataattccaggatcagatcccacccc
cagttcagtgatctctgccagaggaccactgccgtctcctgctgcccgagctggaccctg
gggaattacatcgccattctgaataacagatcatcctgtcagaagattgtcgagcgagat
gtctctcacacgctgaagctgctccggacctgcgccaagcactaccaaaacggcaccctg
gggccagactgctgggacaaggcggccagaaggaaggaccagctcaagtgcaccaacgtg
ccgcgcaagtgtaccaaatacaatgccgtgtaccagattctccactacctggtagacaag
gacttcatgaccccaaagacggctgactacgccgtgccagctttaaagtacagcatgctc
ttctccccgacagagaaaggggagagcatgatgaacatttacctggacaactttgaaaac
tggaactcctcagacggcatcaccaccgtcaccgggatcgagtttggaatcaaacacagc
ttgttccaggattacctcctcatggacaccgtgtaccccgccattgccatcgccatcgtc
ctgctcatcatgtgtgtctacaccaagtccatgttcatcacactcatgaccatgtttgcc
attatcagctcactgatcgtctcctacttcctctaccgagttgtctttaacttcgagttt
ttcccctttatgaacctcaccgcgctcatcatcctggtcgggattggcgcggatgatgct
tttgtcctgtgcgacgtctggaactacaccaagttcgacaagcctcgtgcggaaacgtca
gaggcagtgagcgtcaccttgcagcacgcggccctctccatgtttgtcaccagctttacc
accgccgccgccttctacgctaactacgtcagcaacatcacggcaatcaggtgcttcggg
gtgtacgcggggaccgccatattagtgaattacgtcttgatggtcacctggctcccggct
gtcattgttctgcatgagcgctacctcctcaatgtcttcacctgcttcaggaagccgcag
cctcaagcctaccacaagagctgctgggcagtgctctgccagaagtgccgcagggtgctc
tttgctgtctcagaggcatctcggattttctttgaaaaggtgctgccgtgcatcgtcatc
aagtttcgctacctttggctcatctggttccttgccctgactgtgggcggggcctacatc
gtgtgcgtaaacccaaagatgaaactgccgtcgctggagctgtcggagttccaggtgttc
agatcctctcatcctttcgagcgctatgatgccgagttcaagaagcttttcatgtttgag
cgggttcaccacggagaggagctgcatatgcccatcacagtgatctggggcgtgtcccca
gaagacagcggcgaccctctgaaccccaagagcaaaggggagctgacactagatagcacg
ttcaacattgctagcccggcctcccaggcctggattttacacttctgtcagaaactgagg
aaccagaccttcttccaccagactgagcagcaggacttcaccagctgtttcatcgagacc
ttcaaacagtggatggagaaccaggactgtgacgaacctgccctgtatccctgctgcagc
cactgcagctttccctataaacaagaggttttcgagctgtgcatcaagaaggccatcatg
gagctggacaggagcacagggtaccacctgaataacaagacccccgggccaaggttcgac
atcaacgacaccatcagggctgtggtgctggagttccagagcaccttcctcttcaccctg
gcctatgagaagatgcagcagttctacaaggaggtggactcgtggatttcccatgagctg
agttcggctcccgagggcctcagccgcggctggtttgtcagcaacctggagttctacgac
ctgcaggatagcctttccgatggcaccctcattgccatggggctctcggtggccgttgcc
ttcagtgtgatgctgctgaccacgtggaatatcatcataagcctgtatgccatcgtctcc
atagctggaaccatatttgtcacagtcgggtccctcgtcctgctgggctgggagctgaat
gtgctggagtctgtcaccatctcggtcgcagtcggcctgtctgtagactttgccgtccac
tacggggtggcgtaccgcttggctccagatcccgaccgagaaggcaaggtcatcttctct
ctgagccgtatgggctctgcgatcgccatggctgcactgaccaccttcgtggcgggggcc
atgatgatgccctccaccgtcctggcttacacacagctgggcacattcatgatgctggtc
atgtgcgtgagctgggccttcgccaccttcttcttccagtgcctgtgtcggtgcctgggg
ccgcaaggcacctgtggccagattcctttccctacaaagctccagtgcagtgccttttcc
cacaccttgtctgcaaggcctggggacaggggaccaagcaaaacacacgccgccagtgct
tacagtgtagatgccaggggccagaaatcccaactggaacatgagttttacgagttacag
cccctggcatctcacagctgtacttcttcagagaagaccacttatgaagagccacacacc
tgctccgaatttttcaatggccaagcaaagaatttaaggatgcctgtgcctgcagcctac
agcagcgaactcaccaaaagccccaacagtgagccaggctcagccttgttgcagccctgt
ctggagcaggacactgtgtgtcacttctctctcaacccgagatgtaactgcccagatgcc
tacacacacttaaagtacggattgccagaaatccactgccagcagatgggtgactcctta
tgccacaagtgtgcctccactgcaggtggctttgtccagattcagaatgcggtggcgcct
ctgaaggcctcacaccgagctgccgagggccttctgcaccctgcccagcacatgctgccc
ccagggatgcagagttctcggcctaggaatttctttctgcacccagtgcagcactttcag
gcccaagaaaacctgggtcacaccagcacacacagcacggatgagcatcttcccaggaca
gaaccgccaccaccaccgtctgacagcaggagcaccgagtctttccaaagagcttgttgc
gatcctaagactaaccaaaggagactctgcaaaagtagagacacaggggacacagagggc
agtggggggacagaaaccaaggtctctagtttaccaaaccagactgacaaggaggagaag
caagaggagccaagcctgctgcagaccggtgacactgtgcactcagaacatttgaatcgt
aacgaatcaaactttacattcagccatgtaccaggggaggctggctgcaggtcctgccca
aacagtccacagagtagcagaagcattgtgagattgaagtgcgggtctgcggactgccag
acgccaaacctcgaagccaatgtgcctgctgtaccaacacactcagacctgtctggcgaa
agtctgttgataaaaacactataa

DBGET integrated database retrieval system