KEGG   Mus pahari (shrew mouse): 110321877
Entry
110321877         CDS       T05929                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04064  NF-kappa B signaling pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04621  NOD-like receptor signaling pathway
mpah04668  TNF signaling pathway
mpah05132  Salmonella infection
mpah05145  Toxoplasmosis
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110321877
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110321877
   04064 NF-kappa B signaling pathway
    110321877
   04668 TNF signaling pathway
    110321877
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110321877
   04215 Apoptosis - multiple species
    110321877
   04217 Necroptosis
    110321877
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110321877
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110321877
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321877
   05202 Transcriptional misregulation in cancer
    110321877
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110321877
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110321877
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110321877
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110321877
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110321877
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110321877
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110321877
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I32: IAP family
   110321877
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110321877
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039
Other DBs
NCBI-GeneID: 110321877
NCBI-ProteinID: XP_021054114
LinkDB
Position
5
AA seq 522 aa
MLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASLHSPSMSPVKSRFAHSSPLEQGGIHSNL
CSNPLNSRAVEDFSSRMNPCSYAMSTEEARFHTYSMWPLSFLSPAELARAGFYYIGPGDR
VACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQTHSARMRTFL
YWPLRVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRCWEPGDDPWIEHAKWFPRCEFLI
RMKGQEFVDEIQARYPHLLEQLLSTSDTPEEENADPTETVMHFGPGENSEDAVMMGTPVV
KAALEMGFSRSLVRQTVQRQILATGENYRTVSDIVSALLNAEDERREEEKERQTEEMASD
DLSLIRKNRMALFQQLTHVLPILDNLLEASVITKQERDIIRQKTQIPLQARELIDTVLVK
GNAAANIFKNSLKEIDSTLYENLFVEKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMD
REVSIVFIPCGHLVVCQACAPSLRKCPICRGTIKGTVRTFLS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgttggataactggaaacaaggggacagtcctgttgaaaagcacagacagttctatccc
agctgcagctttgtacagaccctgctttcagccagtctgcactctccgtctatgtctcct
gtgaaaagtcgatttgcacattcgtcacctctggaacaaggtggcattcactccaacctg
tgctctaaccctcttaattctagagcagtggaagacttctcatcgaggatgaatccctgc
agctatgccatgagtacagaggaggccagatttcatacttacagtatgtggcctttaagt
ttcctgtcaccagcagagctggccagagctggcttctattacatagggcctggagacagg
gtggcctgttttgcctgtggtggaaaactgagcaactgggaaccgaaggatgatgctatg
tcagagcatcgcagacattttccccactgtccatttctggaaaatacttcagaaacacag
aggtttagtatatcaaatctaagtatgcagacacactctgctcgaatgaggacatttcta
tactggccacttagggttcctgttcagcccgagcagcttgcaagtgctggattctattat
gtggatcgcaatgatgatgtcaaatgcttttgttgtgatggtggcttgagatgttgggaa
cccggagatgacccctggatagaacacgccaaatggtttccaaggtgtgagttcttgata
cggatgaagggtcaggagtttgttgatgagattcaagctaggtatcctcatcttcttgag
cagctgttgtccacttcagacaccccagaagaagaaaatgctgaccctacagaaacagtc
atgcattttggccctggagaaaattcggaagatgccgtcatgatgggtacgcctgtggtt
aaagcggccttggaaatgggcttcagtaggagcctggtgagacagacggttcagcgtcag
atcctggcgactggcgagaactacaggactgtcagtgatattgtctcagcacttctgaat
gctgaagatgagagaagagaagaggagaaggaaagacagactgaagagatggcatcagat
gacttgtcactgattcggaagaatagaatggccctctttcaacagttgacacatgtcctt
cctatcctggataatcttcttgaggccagtgtaattacaaaacaggaacgtgatattatt
agacagaaaacacagatacccttacaagcaagagagcttattgacaccgtcttagtcaag
ggaaatgctgcagccaacatcttcaaaaactctctgaaggaaattgactccacattatat
gaaaacttatttgtggaaaagaatatgaagtatattccaacagaagacgtttcaggcttg
tcattggaagaacagttgcggagattacaagaagaacgaacttgtaaagtgtgtatggac
agagaggtttctattgtgttcattccttgtggtcatctagtagtctgccaggcgtgtgcc
ccttctctaaggaagtgccccatctgcagggggacaatcaaggggactgtgcgcacattt
ctctcatga

KEGG   Mus pahari (shrew mouse): 110327576
Entry
110327576         CDS       T05929                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04064  NF-kappa B signaling pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04621  NOD-like receptor signaling pathway
mpah04668  TNF signaling pathway
mpah05132  Salmonella infection
mpah05145  Toxoplasmosis
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110327576
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110327576
   04064 NF-kappa B signaling pathway
    110327576
   04668 TNF signaling pathway
    110327576
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110327576
   04215 Apoptosis - multiple species
    110327576
   04217 Necroptosis
    110327576
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110327576
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110327576
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327576
   05202 Transcriptional misregulation in cancer
    110327576
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110327576
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110327576
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110327576
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110327576
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110327576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110327576
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110327576
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I32: IAP family
   110327576
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110327576
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 CARD DUF2039
Other DBs
NCBI-GeneID: 110327576
NCBI-ProteinID: XP_021062309
Ensembl: MGP_PahariEiJ_G0014639
LinkDB
Position
10
AA seq 512 aa
MESSSILSNWTKESKEKMKFDFSCELYRMSTYSAFPRGVPVSEXSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASLHSXSMSPVKSRFAHSSPLEQ
GGIHSNLCSNPLNSRAVEDFSSRMNPCSYAMSTEEARFHTYSMWPLSFLSPAELARAGFY
YIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQTHS
ARMRTFLYWPLSVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRCWEPGDDPWIEHAKWF
PRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPEEENADPTGSYNMPLAGFELWIFW
PKALSTVLQVYATSPGFVHWIMSPPANVTVSDIVSALLNAEDERREEEKERQTEEMASDD
LSLIRKNRMALFQQLTHVLPILDNLLEASLSLEEQLRRLQEERTCKVCMDREVSIVFIPC
GHLVVCQACAPSLRKCPICRGTIKGTVRTFLS
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggagagtagctcaatcttgtcaaattggacaaaagagagcaaagaaaaaatgaagttt
gacttttcgtgtgaactctacagaatgtccacatattcagcttttcccaggggagttcct
gtctcggagnggagtctggctcgtgctggcttttattatacaggtgtgaatgacaaagtc
aagtgcttctgctgcggcctgatgttggataactggaaacaaggggacagtcctgttgaa
aagcacagacagttctatcccagctgcagctttgtacagaccctgctttcagccagtctg
cactctcngtctatgtctcctgtgaaaagtcgatttgcacattcgtcacctctggaacaa
ggtggcattcactccaacctgtgctctaaccctcttaattctagagcagtggaagacttc
tcatcgaggatgaatccctgcagctatgccatgagtacagaggaggccagatttcatact
tacagtatgtggcctttaagtttcctgtcaccagcagagctggccagagctggcttctat
tacatagggcctggagacagggtggcctgttttgcctgtggtggaaaactgagcaactgg
gaaccgaaggatgatgctatgtcagagcatcgcagacattttccccactgtccatttctg
gaaaatacttcagaaacacagaggtttagtatatcaaatctaagtatgcagacacactct
gctcgaatgaggacatttctatactggccacttagtgttcctgttcagcccgagcagctt
gcaagtgctggattctattatgtggatcgcaatgatgatgtcaaatgcttttgttgtgat
ggtggcttgagatgttgggaacccggagatgacccctggatagaacacgccaaatggttt
ccaaggtgtgagttcttgatacggatgaagggtcaggagtttgttgatgagattcaagct
aggtaccctcatcttcttgagcagctgttgtccacttcagacaccccagaagaagaaaat
gctgaccctacagggtcttataatatgcccctggctggctttgaactttggatcttctgg
cctaaggctctgagcactgtattacaggtatatgccacctcacctggctttgtccactgg
attatgtcgcctcctgctaatgtgactgtcagtgatattgtctcagcacttctgaatgct
gaagatgagagaagagaagaggagaaggaaagacagactgaagagatggcatcagatgac
ttgtcactgattcggaagaatagaatggccctctttcaacagttgacacatgtccttcct
atcctggataatcttcttgaggccagcttgtcattggaagaacagttgcggagattacaa
gaagaacgaacttgtaaagtgtgtatggacagagaggtttctattgtgttcattccttgt
ggtcatctagtagtctgccaggcgtgtgccccttctctaaggaagtgccccatctgcagg
gggacaatcaaggggactgtgcgcacatttctctcatga

KEGG   Mus pahari (shrew mouse): 110328081
Entry
110328081         CDS       T05929                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04064  NF-kappa B signaling pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04621  NOD-like receptor signaling pathway
mpah04668  TNF signaling pathway
mpah05132  Salmonella infection
mpah05145  Toxoplasmosis
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110328081
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110328081
   04064 NF-kappa B signaling pathway
    110328081
   04668 TNF signaling pathway
    110328081
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110328081
   04215 Apoptosis - multiple species
    110328081
   04217 Necroptosis
    110328081
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110328081
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110328081
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328081
   05202 Transcriptional misregulation in cancer
    110328081
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110328081
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110328081
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110328081
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110328081
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110328081
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110328081
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110328081
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I32: IAP family
   110328081
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110328081
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 110328081
NCBI-ProteinID: XP_021063101
Ensembl: MGP_PahariEiJ_G0014640
LinkDB
Position
10
AA seq 602 aa
MNMVQDSAFLAKLMRSADSFELKYDFSCELYRLSTYSAFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDSPIEKHRKLYPSCSFVQTLNPANSLEASPQPCLPSTAMST
MPSCFASSENTAYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWP
LSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQ
SALRYTVSNLSMQTHAARVRTFSNWPSSALVHSQELASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENAEAA
IMHFGPGESSEDVVMMGTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVSDLVVGLL
DAEDEMREERTEQAAEEEESDGLALIRKNKVVLYQHLMCVTPMLYCLLSASTITEHECEA
VKQKPHTLQASTLIDTVLAKGNTAVTAFRNSLQEIDPALYRDIFVQQNIRSLPTDDIAAL
PMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgaacatggttcaagacagcgcctttctagccaagctgatgaggagtgctgacagcttt
gagctgaagtatgatttttcctgtgagctgtaccgattgtccacatattcagctttcccc
gctggagttcctgtgtcagaaagaagtctggctcgtgctggcttttactacactggtgtc
aatgacaaggtcaagtgcttctgctgtggcctgatgctagacaactggaaacaaggggac
agtcccattgagaagcacagaaagctgtatcccagctgcagctttgtacagactttgaac
ccagccaacagtctggaagctagtcctcagccttgtcttccttccacagcgatgagcacc
atgccttcgtgctttgcaagttccgagaacactgcctatttcagtggctcttactcaagc
tttccctcagaccctgtgaacttccgagcaaatcaagattgtcctgctttgagcacaagt
ccctaccactttgcaatgaacacagagaaggccagattactcacctatgaaacatggcca
ttgtcttttctgtcaccagcaaagctggccaaagcaggcttctactacataggacctgga
gatagagtggcctgctttgcatgcgatgggaaactgagcaactgggaacgtaaggatgat
gctatgtcagagcaccagaggcatttccccagctgcccattcttaaaagacttgggtcag
tctgctttgagatacactgtctctaacttgagcatgcagacacatgcagctcgtgttaga
acattctctaactggccttctagtgcgctagttcattcccaggaacttgcaagtgcgggc
ttttattatacaggacacagtgatgacgtcaagtgtttttgctgtgatggtgggctaagg
tgctgggaatctggagatgacccctgggtggaacatgccaagtggtttccaaggtgtgag
tacttgatcagaatcaaaggccaagagtttgtcagccaagttcaagctggctaccctcat
ctacttgagcagctattatctacgtcagactccccagaagatgagaatgcagaagcagca
atcatgcattttggccctggagaaagttcggaagatgtcgtcatgatgggcacgcctgtg
gttaaagcggccttggaaatgggcttcagtaggagcctggtgagacagacggttcagcgt
cagatcctggcgactggcgagaactacaggactgtcagtgacctcgttgtaggcttactc
gatgcagaagacgagatgagagaggagcggacagagcaggcggccgaggaggaggagtca
gatggtctagcattaatccggaagaacaaagtggtgctttaccaacatttgatgtgtgtg
acaccaatgctgtattgcctcctaagtgcaagcaccatcactgaacacgagtgcgaggct
gtgaaacagaaaccacacaccttacaagcaagcacactgattgacactgtgttagcaaaa
ggaaacactgcagtgaccgcattcagaaactcccttcaggaaatcgaccctgcgttatac
agagatatatttgtgcaacagaacattaggagccttcccacagatgacattgcagctcta
ccaatggaagaacagttgcggaaactccaggaagagagaatgtgtaaagtgtgtatggac
cgagaggtgtccatcgtgttcattccctgtggccatctggtcgtgtgcaaagactgcgct
ccctctctgaggaagtgtcccatctgtagagggaccatcaagggcacagtgcgcacattt
ctctcctga

KEGG   Mus pahari (shrew mouse): 110332414
Entry
110332414         CDS       T05929                                 

Gene name
Birc5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04390  Hippo signaling pathway
mpah05161  Hepatitis B
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110332414 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110332414 (Birc5)
   04215 Apoptosis - multiple species
    110332414 (Birc5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332414 (Birc5)
   05207 Chemical carcinogenesis - receptor activation
    110332414 (Birc5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110332414 (Birc5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110332414 (Birc5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110332414 (Birc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110332414 (Birc5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110332414 (Birc5)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I32: IAP family
   110332414 (Birc5)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     110332414 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110332414 (Birc5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 110332414
NCBI-ProteinID: XP_021069301
Ensembl: MGP_PahariEiJ_G0018600
LinkDB
Position
14
AA seq 142 aa
MGAPALPPTWQLYLKSHRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVREFLKLDKQRAKNKIAKETNNK
QKEFEETAKTARQSIEQLAALR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggggctccggcgctgcccccgacctggcagctgtacctcaagagccaccgcatcgcc
accttcaagaactggcccttcctggaggactgcgcctgcaccccagagcggatggcggag
gctggcttcatccactgccctaccgagaacgagcctgacttggcccagtgttttttctgc
tttaaggaattggaaggctgggaacccgatgacaaccctatagaggagcatagaaagcac
tcgcctggctgtgccttcctcactgtcaagaagcagatggaagaactgaccgtcagagaa
tttctgaaactggacaaacagagagccaagaacaaaattgcaaaggagaccaacaacaag
caaaaagagtttgaagaaactgcaaagactgcccgtcagtcaattgagcagctggctgcc
ttgcgctga

DBGET integrated database retrieval system