KEGG   Mus pahari (shrew mouse): 110321916
Entry
110321916         CDS       T05929                                 

Gene name
Npas2
Definition
(RefSeq) neuronal PAS domain-containing protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110321916 (Npas2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110321916 (Npas2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110321916 (Npas2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 110321916
NCBI-ProteinID: XP_021054178
Ensembl: MGP_PahariEiJ_G0027315
LinkDB
Position
5
AA seq 816 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFVIVVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEFLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKDICFIATVRLATPQFLKE
MCVADEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPTEAMHPSALKEKDSSLEPPQHFNALDMGASGLTSSPSPSASSKSSHKSSH
TAMSEPTSTPTKLMAENSTTALPRPATLPQELPVQGLSQSATMPAPLHSSSSCDLTKQLL
PQSLPQTSLQSPPTLVTQFSTQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCL
VQDSNVQMFLQQPAVSLSFSSAQRPAAQQQLQQRPAAPSQPQLVVNTPLQGQIASTQVTN
QHLLRESNVISAQGPKPMRSSQLLPASSRSLSSLPSQFSSTASVLPPGLSLTTVAPTPQD
ASQCQPSPDFGHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQVMFPSPD
SHPTSSSASTPVLLMGQAVLHPSFPVSRPSPLQPAQAQQQPPPYLQAPTSLHSEQPDSLL
LSTFSQQPGTLGYAATQSTPPQPPRPSRRVSRLSES
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggacgaagatgagaaggatagagcaaagagagcctctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagctccatgctcccggggaacact
cggaaaatggacaaaaccaccgtgctggagaaggtcatcggattcttgcagaaacacaat
gaagtctcagcacaaacagaaatctgtgacatccagcaggactggaagccttcattcctc
agtaacgaagaattcacccagttgatgttggaggcattagatggcttcgtcatcgtcgtg
acaacagacggcagcatcatctatgtgtccgacagtatcacacctctccttggacattta
ccgtcggatgtcatggatcagaacttgttaaatttccttccagagcaagaacattccgaa
gtttataaaatcctttcctcccatatgcttgtgacggattccccctccccagaattccta
aaatctgacaacgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttacgaatatataaaatttgttggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggctttgacaacaccctttcaagaccctgccgtgtgccccta
ggaaaggacatctgcttcatcgccaccgtgcgcctggcaaccccgcagttcttaaaggaa
atgtgtgtagctgacgaacctttagaggaattcacttcgaggcatagcttggaatggaaa
tttttatttctggatcacagagcccctccaatcataggatacctgccctttgaagtactc
ggcacctcaggctacgactactaccacattgatgacctggagctcctggccaggtgccac
cagcacctgatgcaatttggcaaagggaagtcgtgttattaccggtttctaaccaaaggg
cagcagtggatttggttgcaaacccactactacatcacctaccaccaatggaactccaag
cctgagttcatcgtatgcacgcactcggtggtcagttacgcagatgttcgagtggaaagg
agacaggagctggctctggaagacccacccacagaggccatgcacccctctgcactgaag
gaaaaggactcaagcctggagcctccacagcactttaatgcacttgacatgggtgcctca
ggtcttaccagcagtccttcgccatcagcctcctcaaagagttcccacaagtcctcacac
acagccatgtcagaacccacctccactccaaccaagctgatggctgagaacagcaccaca
gctttgccaagaccggccaccctaccccaggagttaccagtgcaggggctcagccagtca
gccacaatgccggctcctctgcattcttcatcctcctgtgacctcacaaaacagctcctg
cctcagagcctgcctcagaccagcttgcagagtccacctactctagtgacgcagttttca
acacaattcagcatgttccagaccattaaagaccaactggagcagaggacacggatcctg
caggccaacattcggtggcagcaggaagagcttcacaagattcaggaacagctctgcctg
gtccaggactccaacgtccagatgtttctgcagcagccagctgtgtccctgagcttcagc
agtgcgcagcgaccagcagctcagcagcagctgcagcaaaggcccgctgcaccgtctcag
ccccagcttgtggtcaacactccactgcaggggcagatcgcgtccacccaagtcacaaac
cagcacctgctccgagaatcgaatgtgatatccgcccagggtccaaagccaatgagaagt
tcccagctgctgcctgccagcagccgttcactgagcagcctgccgtcccagtttagcagt
acagcttccgtgctcccgcccggcctgagcctcaccacggttgctcccacccctcaggat
gccagccagtgccagcccagccctgacttcggccatgatcggcagctcaggttgttgctg
agccagcccatccagcctatgatgcctgggtcctgcgatgccaggcagccctcagaagtc
agcaggactggacggcaagtcaagtatgcacagagccaggtgatgtttccaagtccagac
tcgcaccccaccagcagcagcgcctccaccccggttctgctcatggggcaggcagtgctc
caccccagcttccctgtgtcccggccatcacccctgcagccagcacaggcacaacagcag
ccaccaccctatctgcaggcaccaacatctctgcacagtgagcagccggactcgctcctt
ctctccaccttctcccagcagccgggaaccctgggctacgcagccacacagtctacacca
ccgcaacccccacgcccttcccgcagggtcagccggctgtcagagtcctaa

KEGG   Mus pahari (shrew mouse): 110330520
Entry
110330520         CDS       T05929                                 

Gene name
Clock
Definition
(RefSeq) circadian locomoter output cycles protein kaput
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110330520 (Clock)
  09159 Environmental adaptation
   04710 Circadian rhythm
    110330520 (Clock)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110330520 (Clock)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110330520 (Clock)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110330520 (Clock)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110330520 (Clock)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110330520 (Clock)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 DUF6080
Other DBs
NCBI-GeneID: 110330520
NCBI-ProteinID: XP_021066325
Ensembl: MGP_PahariEiJ_G0017094
LinkDB
Position
13
AA seq 863 aa
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPTHEKMTQRRSSF
SSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNVQQLTPINMQGQV
VPANQIQSGMNAGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPNQTPSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQPQQQPQQQQQQQQSSQEQ
QLPSVQQAAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQ
QQQQQLPRHRTDSMTDPSKVQPQ
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgttctcattaaggagctgggctctatg
cttcctggtaacgctagaaagatggacaagtctactgttctacagaagagcattgatttt
ttgcgcaaacataaagaaatcactgcacagtcagatgctagtgagattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagagtgtaacttcg
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactctctactcatctgctggaaagtgactcatta
acccctgagtacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgaggg
acaatagacccaaaggagccgtccacctatgaatatgtgagatttataggaaactttaaa
tctttaaacagtgtatcaacttcaacacataatggttttgaaggaactatacaacgcaca
cataggccttcttatgaagatagagtttgtttcgtagctactgtcagattagctacacct
cagttcatcaaggaaatgtgtactgttgaagaaccaaatgaagagtttacatctagacac
agtttagaatggaagtttctatttttagatcacagggcaccaccaataataggctatttg
ccatttgaagtcttgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcatgagcacttaatgcaatatggaaaaggcaaatcgtgttactatagg
ttcctgaccaaaggacagcagtggatttggcttcagactcattattacattacttaccat
cagtggaattcaaggccagagttcattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtatcaacacagtgagtctgaaggaagca
ctggaaaggtttgatcacagcccaactccttctgcctcctctagaagctccagaaagtca
tctcacacagcagtctcagacccttcctccacaccgacaaagatccctactgatactagc
actcctcccagacagcatttgccaactcatgaaaagatgacacagcggaggtcatccttc
agcagtcagtccataaactcccagtcagttggtccatcattaacacagccagcgatgtct
caagctgcaaatttaccaattccacaaggcatgtcacagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccagctagagcagcggacacggatgatagaggcaaat
attcatcggcagcaagaagaactaaggaagattcaggagcaacttcagatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggtttgaattttggttctgttcaa
ctttcctctggaaattctaatgtccaacaactgacacctataaatatgcaaggccaagtt
gtccctgctaaccagattcagagtggaatgaatgctggacatatcagcacaggccagcac
atgatacagcaacagactttacaaagtacatcaactcagcagagtcaacagagtgtaatg
agtggacacagtcagcaaacgtctctcccaaatcagacaccgagcacgcttacagcccca
ctgtacaacacgatggtgatttctcagcccgcggctgggagcatggtccagattccatcc
agtatgccacagaacagtacccagagtgctacagtcactacgttcactcaggacagacag
ataagattttctcaaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgt
ggggccgtcatggtaccaagtaccatgcttatgggtcaggtggtgactgcctatcctacc
tttgccacacaacagcagcaggcacagacgttatcagtaacacaacagcagcagcagcag
cagcaaccacagcagcaaccacagcaacagcagcaacaacagcagagttcccaggaacag
cagctgccttcagttcagcaggcagctcaggcccagctgggccagccaccacagcagttc
ttacagacgtctaggttgctccatgggaatccttcgacacagctcatcctctctgctgcc
tttccactacaacagagcactttccctccttcgcaccaccagcaacaccagcctcagcag
cagcagcagcagcagcttcctcggcacaggactgacagcatgaccgacccttccaaggtc
cagccacagtag

DBGET integrated database retrieval system