KEGG   Mus pahari (shrew mouse): 110322001
Entry
110322001         CDS       T05929                                 
Symbol
C4bpb
Name
(RefSeq) LOW QUALITY PROTEIN: C4b-binding protein beta chain
  KO
K04003  complement component 4 binding protein beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322001 (C4bpb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    110322001 (C4bpb)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 110322001
NCBI-ProteinID: XP_021054220
LinkDB
Position
5:complement(104979095..104984051)
AA seq 267 aa
MLCWIVCCLLWLSSALDGSCSXLPLVDNSRFVGKETEEQIQGVYLCMEGDHLVGKQSLVF
XPSKEWNASLPECQWELVGHCQDPVLENGKISSGPXECNDSYILKGSNWSQCLEDHNWAP
PFPVCQSRDCEPPGTPVYGYFEGETFTSGSVVTYYCEDGYDLVGTQMLQFIHGEWNSSYP
TCESIQETPKPAEESALEKAIFAFQESKEXATENFVRRLKEGGLTMEELKYSLEMKKTKL
KAGILLNDRMVTDITPMNKLLLKVLAS
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctttgttggatcgtgtgctgtctgctatggctgagttctgccttagatgggagctgt
tcataacttcctctagtggacaacagcagatttgttggaaaggaaacagaagaacagatt
cagggagtttacctgtgtatggaaggcgaccacttggtgggaaagcagtctttggtcttt
ngtccctcaaaggaatggaatgcttccctccctgagtgccagtgggagttggtgggccac
tgtcaagaccctgtacttgaaaatggcaagatcagttccgggcctngtgagtgcaatgac
agttacattctcaagggaagcaactggagccagtgtctagaggaccacaactgggcccct
ccctttcccgtctgccaaagtagagactgtgaacctcctgggactcctgtctatggctac
tttgagggtgaaactttcacttcaggctctgttgttacttattactgtgaagatgggtat
gacctagtgggcacacagatgctgcagttcattcatggggagtggaacagttcctatcct
acctgtgagtccattcaagaaacccctaaacctgctgaagagagtgcacttgagaaagca
atttttgcctttcaggagagtaaggagnncgctacagagaactttgtgagaagactaaag
gaaggtgggctaacgatggaagaacttaaatattccctggagatgaagaaaactaagttg
aaggctggtattttactgaatgacagaatggtcaccgacataacacctatgaataaactg
cttctaaaggtgctcgcgagttga

KEGG   Mus pahari (shrew mouse): 110322103
Entry
110322103         CDS       T05929                                 
Symbol
C4bpa
Name
(RefSeq) C4b-binding protein alpha chain
  KO
K04002  complement component 4 binding protein alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322103 (C4bpa)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    110322103 (C4bpa)
SSDB
Motif
Pfam: Sushi C4bp_oligo
Other DBs
NCBI-GeneID: 110322103
NCBI-ProteinID: XP_021054282
Ensembl: MGP_PahariEiJ_G0027788
LinkDB
Position
5:complement(104908810..104956641)
AA seq 578 aa
MITWSYLELWKTSHSTLLQMTLATVLMAPVLGDCGPPPILPFASPINQLYESTTFPSGTV
LKYTCHHGFKRVNSSHLSCDENGSWVYSAFCVRRRCKNPGELVNGKVEIPSNLLVGSIIE
FSCSKGYLLIGSATSRCEVQGKGVDWSDSLPECVIATCEPPPPISNGKHSGRDDDLYTFG
SIVIYSCDPTFILLGNASIVCTVVNRTVGVWRPHPPACQKIICHRPQIPKGYLAPGFRQF
YAYRDALEIGCKKGFILRGSSVIHCEANGEWFPSIPTCEPNGCINVPDIPYASWEEYKIP
LRNFEVFEIGAKLKYQCKPGYRARLNDPQIVTCQENLTWSSSNGCERICCPTPNLEKIKI
VSERRDFTGTCIYAYGDYVFYICNEGSYPMSTDGRSSCQADGKWDPAIPSCQADSGLQNR
LALTFPNISETNVMNKTYLFSHEENSTESSMKGVCPKPMVINGNLSVERAIYAELENITI
QCDPGYTIVGSPNIICSNKTWYPEIPNCKMGVPEDCRLVSKGRQLLQCLSSPEDVHRALK
VYKLFLEIERLEHQKEKWIRLHRKPQYMKINGSFRPCS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgataacctggtcctaccttgagctgtggaaaacctctcattcaactctgctccaaatg
accttggccactgttctgatggctcctgttcttggtgattgtggacctccacccatttta
ccgtttgcttctccaatcaaccagttgtatgagtcaacaaccttcccatctggaactgtc
ctgaaatatacctgccatcatggcttcaagagagtcaattcaagccatctttcttgtgat
gagaatggttcatgggtctatagtgccttttgtgtcaggagacgatgcaaaaacccaggc
gagttggtcaatgggaaagtagaaattccatctaaccttttggtaggctcaatcatagag
ttcagctgctcaaagggctatcttctgattggttcagcaactagtcggtgtgaggtccaa
ggtaaaggagttgactggagtgattctctcccagaatgtgtaattgccacgtgtgagccc
cctccacccatcagcaatgggaagcacagtggtagagatgatgacctgtacacatttggc
tccatagtcatctacagttgtgatcccaccttcatactccttggcaatgcctccattgtc
tgcactgtggtgaacagaacagtgggtgtttggagaccacaccctcctgcctgtcaaaaa
atcatctgccatcggccgcagattccgaagggatacttggcccctggatttcgacagttc
tatgcgtacagagacgctcttgagatcggatgcaagaagggttttatcctcagaggcagc
agtgtgatccactgtgaggcaaacggcgagtggtttccttctattcccacctgtgaaccc
aatggttgtatcaatgtaccagatattccctatgcttcctgggaagaatataagattcca
ttaagaaattttgaagtatttgaaattggggccaaattgaaataccagtgcaagcctggc
taccgagcacgtcttaatgatccccagattgtgacttgtcaggaaaacctgacctggtct
tcttctaatggatgtgaaaggatatgttgcccaacaccaaatttagagaaaatcaaaatt
gtgagtgaaaggagagatttcactggcacatgcatctatgcctatggagactatgttttc
tacatttgtaatgaaggctcttaccctatgtctacggatggaaggagttcatgtcaagca
gatggaaaatgggaccccgcaataccatcatgtcaggcagactcaggcctgcaaaaccgt
cttgctctcaccttcccaaacatatcagaaaccaatgtgatgaacaaaacctatctattt
agtcatgaagaaaactcaacagagagttccatgaaaggtgtgtgtcccaaaccaatggtc
ataaatggaaacttgtctgtggagagagctatctatgcggaactggaaaatatcaccatt
caatgtgatcctggatataccatagttggttccccaaacatcatttgttcaaacaaaaca
tggtatcctgagatacccaactgtaagatgggggtcccggaagactgcagactagtgagc
aaaggaagacaactcttgcagtgcctctcaagcccagaagatgtgcatagggccctgaag
gtgtacaagctatttctagagatcgaacgattggaacatcagaaagagaagtggatacgg
ttacacaggaaacctcaatatatgaaaataaatgggtcatttaggccttgcagttag

DBGET integrated database retrieval system