KEGG   Mus pahari (shrew mouse): 110322112
Entry
110322112         CDS       T05929                                 
Symbol
Selp
Name
(RefSeq) P-selectin
  KO
K06496  selectin, platelet
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04613  Neutrophil extracellular trap formation
mpah05144  Malaria
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322112 (Selp)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110322112 (Selp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110322112 (Selp)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110322112 (Selp)
  09174 Infectious disease: parasitic
   05144 Malaria
    110322112 (Selp)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110322112 (Selp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110322112 (Selp)
   04090 CD molecules [BR:mpah04090]
    110322112 (Selp)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110322112 (Selp)
   04091 Lectins [BR:mpah04091]
    110322112 (Selp)
Cell adhesion molecules [BR:mpah04515]
 Selectins
  Selectin family
   110322112 (Selp)
CD molecules [BR:mpah04090]
 Proteins
  110322112 (Selp)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   110322112 (Selp)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 4: Selectins
   110322112 (Selp)
SSDB
Motif
Pfam: Sushi Lectin_C EGF EGF_2 EGF_3 hEGF EGF_CA
Other DBs
NCBI-GeneID: 110322112
NCBI-ProteinID: XP_021054294
Ensembl: MGP_PahariEiJ_G0028028
LinkDB
Position
5:136847605..136882401
AA seq 768 aa
MAGCPKGSWKPRLRSVILGAAQLIWFSALISELVNQKEVAAWTYNYSTKAYSWNNSRAFC
RRHFTDLVAIQNKNEIAHLNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADN
EPNNKRNNQDCVEIYIKSNSAPGKWNDEPCVKRKRALCYTASCQDMSCSNQGECIETIGS
YTCSCYPGFYGPECEHVKECGTFDIPQHVLVNCNHPLGEFSFTSQCTFSCAEGYELDGPS
QLQCLASGIWTNNPPKCEAVQCRSLEAPPHGTMACMHPIAAFAYDSSCKFECQPGYRAKG
SNTLHCTGSGQWSEPLPTCEAIACEPPEIPIHGSMDCVPSSGAFGYNSSCTFLCAEGFVL
KGNDVIQCADSGQWTAPAPICEALQCPEFPVPSQAQASCSDPFGTLKYQSVCSFSCDEGS
LLVGASVIRCLATGHWSGAPPECQAVSCTPLLSPENGSMTCVQPLGDSTYKSTCQFTCDE
GFYLSGPERLDCSPSGHWTGTPPTCEAIKCPGIFAPEQGNLDCSHIHGEFGVGSICHFSC
KDDFELLGSENVECTVSGRWSAPPPTCKGVTSFPAPAVRCPALTTPGQGTMSCQHHLGSF
GPNTTCYFGCKTGFTLRGANLLRCRASGQWTTVTPMCRAVKCSELHMDTAIAMNCSSPWG
NFSYGSTCAFQCPEGQSLNGSARATCREDGHWSDTVPTCQAGTVTIQEALTYLGGAVAST
TGLAVGGTLLALLRKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggccggctgcccaaaaggttcttggaaaccaagactccggagtgtgatcctgggagcg
gctcagctcatctggttcagtgctttgatctctgagcttgtaaatcagaaggaagtggct
gcgtggacctataactacagcacaaaggcatactcgtggaataactcacgggcattctgt
aggaggcacttcacagacttagtggccatccagaataaaaatgaaatcgctcacctcaat
gacgtcatcccattcttcaactcttactactggattggtatccgaaagattaacaataag
tggacctgggtgggaaccaataagacgctcacagaggaggccgagaactgggccgacaac
gagcccaacaacaagaggaacaaccaggactgtgtggaaatctacatcaagagtaactcg
gcccctggcaagtggaatgacgaaccctgtgttaaacgaaagcgggccctgtgctacaca
gcctcctgccaggacatgtcctgcagcaaccaaggggagtgcatcgagaccattgggagc
tatacctgctcctgctacccgggcttctatgggccagagtgtgaacacgtcaaggagtgt
ggaacattcgacatcccgcaacatgttctcgtgaactgcaaccatcccctgggggagttc
tccttcacgtcacagtgtaccttcagctgtgctgagggctacgagctggatggacccagc
cagctgcaatgtttggcttctgggatctggacaaataaccccccgaagtgtgaagctgtg
cagtgtcggagcctggaagcccctccccatggaaccatggcctgtatgcacccgattgct
gcctttgcctacgactccagctgtaaatttgagtgccagcctggatatcgagcaaagggt
tccaacacactccactgcactggctctggtcagtggagtgaaccattgccaacctgtgaa
gccattgcgtgtgaacctccggagatccccatccatgggagtatggactgtgtcccatct
tcaggagcctttgggtacaacagcagctgcacttttctctgtgcagaggggttcgtgctg
aagggaaatgatgtcatccagtgtgctgactcggggcagtggacagccccagccccaatc
tgcgaagcattgcaatgtccagagtttccggttccgagtcaagcccaggcgagctgttcg
gatccctttggtaccttgaagtaccagtcggtctgcagcttttcctgtgatgaaggctcc
ctcttggtgggagcaagtgtgataaggtgcctggctactggacactggagtggggctcct
cccgaatgtcaagctgtgtcgtgcacccctttgctcagtcctgagaatggatccatgacc
tgtgtccagcctcttggggattccacctacaaatccacatgccagttcacgtgcgatgaa
ggattttatctatctggaccagaaagattggactgttctccatctggacactggacgggc
acccctcccacgtgtgaagccatcaagtgtccaggaatcttcgccccagagcaaggcaac
ctggattgttctcacatccatggagagttcggtgttggctctatctgtcacttctcctgc
aaggacgactttgagctactgggatctgaaaatgtggaatgcacagtgtctggaagatgg
tcagcgcctccgccaacctgcaaaggtgtaacatcatttcctgccccagcagtccgatgc
cccgccctcacgactcctggacagggcacaatgtcctgccaacaccacctgggaagcttt
ggtccgaacaccacgtgttactttgggtgcaaaactggatttacactcaggggagccaac
ttgctccgctgcagggcttcaggacaatggacaacagtgacccccatgtgcagagccgtc
aagtgctccgaattgcacatggacacagcaatagcaatgaactgttccagtccctgggga
aactttagctatggatcaacctgcgccttccagtgcccagaggggcaatcactgaatggc
tctgcgagggcaacctgccgagaagacggtcactggtcagatactgtgccaacctgccaa
gcagggacagtgacaatccaggaagctctgacttatttgggtggtgcagtggcttctaca
acaggcctggcagtgggcgggacactcctggctctgctaagaaagcgtctcagaaagaaa
gatgatggaaaatgccccttgaaccctcacagccatctaggaacatatggagtcttcact
aacgctgcatatgacccaaccccttaa

DBGET integrated database retrieval system