KEGG   Mus pahari (shrew mouse): 110322166
Entry
110322166         CDS       T05929                                 
Symbol
Cd55
Name
(RefSeq) complement decay-accelerating factor isoform X1
  KO
K04006  decay accelerating factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04640  Hematopoietic cell lineage
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110322166 (Cd55)
   04610 Complement and coagulation cascades
    110322166 (Cd55)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110322166 (Cd55)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322166 (Cd55)
   04090 CD molecules [BR:mpah04090]
    110322166 (Cd55)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110322166 (Cd55)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110322166 (Cd55)
  Exosomal proteins of other body fluids (saliva and urine)
   110322166 (Cd55)
  Exosomal proteins of colorectal cancer cells
   110322166 (Cd55)
CD molecules [BR:mpah04090]
 Proteins
  110322166 (Cd55)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Antigens
  110322166 (Cd55)
SSDB
Motif
Pfam: Sushi DUF6112
Other DBs
NCBI-GeneID: 110322166
NCBI-ProteinID: XP_021054364
Ensembl: MGP_PahariEiJ_G0027786
LinkDB
Position
5:complement(104739344..104791859)
AA seq 412 aa
MIPAQAQGTWPSPPPPLLQLLSLSLLLSLLLLFTTVGGDCGPPPDIPNATPILGRHSKFA
EQSKVTYSCNKGFKQIPDKSNIVVCLENGQWSSHETFCEKSCDAPERLSFASLKKEYLNV
NFFPVGTIVEYECRPGYLKQPLLSGKSTCLEDLAWSPVAQFCKKKSCPNPKDLKNGHINI
PTDILFGSEITFSCDPGYRLVGVSSTFCSVIGNTVDWDDEFPVCTEIFCPDPPKIDNGVM
HGESNSYTYRQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPQCIEKPKVPTKNPT
VTVPSTRIPSTPQKHTTVHVPSTGVLPTPQKPSTVKVTATQHVPVTTTKVRHPTRTSTDK
GESNSGGDRFIYGFVAVIVMIDSLIIVKTLWTVLSSNGSFNFQGKKRKGVSK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgattcctgcgcaggcgcaggggacttggccatcaccaccacctccactgctgcagctg
ctgtcgctgtccttgttgctgtcgctgctgctgctgttcacaactgtaggaggagactgc
ggcccacctccagacattcctaatgccacaccaatcttgggtagacactccaagtttgct
gagcaaagcaaagtgacatactcatgtaataaaggctttaaacaaattccagacaagtca
aacatagtggtctgtcttgaaaatggncaatggtcgagccatgaaacattctgtgagaaa
tcatgtgatgctccagaaagattgagttttgcatccctcaaaaaagagtatctcaacgtg
aattttttcccagttggtactattgtggaatacgaatgtcggccaggatatctaaaacaa
cctctactctcaggaaaatcaacntgccttgaggatttagcatggtctccagttgctcag
ttttgtaaaaaaaaatcatgccctaatcctaaagatctgaaaaatggtcacatcaacata
ccaactgacatattattcggttcagaaataaccttctcatgtgacccagggtacaggcta
gtcggtgtctcctctactttttgttctgttatcggaaatactgttgactgggacgatgaa
tttccagtgtgcacagaaatattttgtccagacccaccgaaaatcgacaatggagtaatg
catggagaaagcaactcttatacatatagacaggtggtcacctattcatgtgacaaaggc
ttcatcctggttggaaatgcttccatttattgtactgtgagcaagtctgatgtaggacaa
tggagcagtccaccaccccagtgcatagagaaacccaaggtcccaactaagaacccaaca
gttactgttccaagtacaagaatcccctcaacgcctcagaaacacaccacagttcatgtt
ccaagtacaggagtcctaccaacgcctcagaaaccttccacagttaaagttacagcaacc
cagcatgtacctgttaccacgacaaaggtacgtcatccaacaagaacatctacagacaaa
ggagagtctaactcaggtggtgaccgttttatatatggatttgttgctgttattgtaatg
atcgatagcctaattatagtcaaaactctctggaccgttttaagttcaaacggaagcttt
aactttcaaggaaagaagaggaagggtgtctcaaagtaa

DBGET integrated database retrieval system