KEGG   Mus pahari (shrew mouse): 110322175
Entry
110322175         CDS       T05929                                 
Symbol
Cd247
Name
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform X1
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah05142  Chagas disease
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110322175 (Cd247)
   04660 T cell receptor signaling pathway
    110322175 (Cd247)
   04658 Th1 and Th2 cell differentiation
    110322175 (Cd247)
   04659 Th17 cell differentiation
    110322175 (Cd247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322175 (Cd247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110322175 (Cd247)
   05169 Epstein-Barr virus infection
    110322175 (Cd247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110322175 (Cd247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322175 (Cd247)
   04090 CD molecules [BR:mpah04090]
    110322175 (Cd247)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110322175 (Cd247)
CD molecules [BR:mpah04090]
 Proteins
  110322175 (Cd247)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 110322175
NCBI-ProteinID: XP_021054385
Ensembl: MGP_PahariEiJ_G0028047
LinkDB
Position
5:138417443..138493145
AA seq 203 aa
MKWKVSVLSCILHVQFPGAEAQSFGLLDPKLCYLLDGILFIYGVIVTALYLRAKFSRTAE
GATYLQDPNQLYNELNLGQREEYDVLDKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMA
EAYSEIGTKGERRRGKGHDGLYQDSHFQAVPGQKREGSELRRALGLRPRPKGESTQQSSQ
SYASVFSVPTLWSPWPPRSSSQL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaagtggaaagtgtctgttctctcctgcatcctccatgtgcagttcccaggagcagag
gcacagagcttcggtctgctggatcccaaactttgctacctgctagatggcatcctcttc
atctacggagtcatcgtcacggccctgtacctgagagcaaaattcagcaggactgcagag
ggtgccacctacctgcaggaccccaaccagctctacaatgaactcaatctagggcaaaga
gaggaatatgatgtcttggacaagaagcgggctcgggatcccgagatgggaggcaaacag
cagaggaggaggaacccccaggaaggcgtgtacaacgcactgcagaaagacaagatggca
gaagcctacagtgagatcggcacgaaaggcgagaggcggagaggcaagggacacgatggc
ctttatcaggacagccacttccaagcagttccgggacagaagagagaaggctcagaactc
agaagggcccttgggttgagaccccgccctaaaggtgaaagcacccagcagagtagccaa
tcctatgccagcgtcttcagcgtccccactctgtggagtccgtggccacccaggagcagc
tctcagctctaa

KEGG   Mus pahari (shrew mouse): 110328470
Entry
110328470         CDS       T05929                                 
Symbol
Cd3g
Name
(RefSeq) T-cell surface glycoprotein CD3 gamma chain
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah05142  Chagas disease
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110328470 (Cd3g)
   04660 T cell receptor signaling pathway
    110328470 (Cd3g)
   04658 Th1 and Th2 cell differentiation
    110328470 (Cd3g)
   04659 Th17 cell differentiation
    110328470 (Cd3g)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110328470 (Cd3g)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110328470 (Cd3g)
   05170 Human immunodeficiency virus 1 infection
    110328470 (Cd3g)
   05162 Measles
    110328470 (Cd3g)
   05169 Epstein-Barr virus infection
    110328470 (Cd3g)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110328470 (Cd3g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110328470 (Cd3g)
CD molecules [BR:mpah04090]
 Proteins
  110328470 (Cd3g)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3
Other DBs
NCBI-GeneID: 110328470
NCBI-ProteinID: XP_021063524
Ensembl: MGP_PahariEiJ_G0015001
LinkDB
Position
10:complement(40095923..40104706)
AA seq 182 aa
MEQRKRLVGLFLVISLLQGTVAKTNKAKNLVQVDDSRGDGSVLLTCGLTDKTIKWLKDGN
IISPLNATKNTWNLGNNAKDPRGMYRCQGAKETSKPLQVYYRMCENCIELHIGTISGFIF
AEIISIFFLAVGVYLIAGQDGVRQSRASDKQTLLQNEQLYQPLKDREHDQYSHLQGNQLR
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcagaggaagcgcctggtgggcctcttcctggtgatctctcttcttcaaggcact
gtagccaagacaaataaagcaaagaatttggtacaagtggatgacagccgaggagacggt
tctgtacttctgacttgtggcttgactgacaagactatcaagtggcttaaagacgggaac
ataataagtcctctaaatgcaactaaaaacacatggaatctgggcaacaatgccaaagac
cctcgaggcatgtatcggtgtcaaggagcgaaggagacatcaaagcccctgcaagtgtat
tacagaatgtgtgagaactgcatcgagctacacataggcaccatatccggctttatcttc
gctgagatcatcagcatcttcttccttgctgttggtgtatatctcattgctggacaggat
ggagttcgtcagtcaagagcttcagacaagcagactctgttgcaaaatgaacagctgtac
cagcccctcaaggaccgggaacatgaccagtacagccatctccaaggaaaccaactgagg
aagaagtga

KEGG   Mus pahari (shrew mouse): 110328514
Entry
110328514         CDS       T05929                                 
Symbol
Cd3d
Name
(RefSeq) T-cell surface glycoprotein CD3 delta chain
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah05142  Chagas disease
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110328514 (Cd3d)
   04660 T cell receptor signaling pathway
    110328514 (Cd3d)
   04658 Th1 and Th2 cell differentiation
    110328514 (Cd3d)
   04659 Th17 cell differentiation
    110328514 (Cd3d)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110328514 (Cd3d)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110328514 (Cd3d)
   05170 Human immunodeficiency virus 1 infection
    110328514 (Cd3d)
   05162 Measles
    110328514 (Cd3d)
   05169 Epstein-Barr virus infection
    110328514 (Cd3d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110328514 (Cd3d)
  09163 Immune disease
   05340 Primary immunodeficiency
    110328514 (Cd3d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110328514 (Cd3d)
CD molecules [BR:mpah04090]
 Proteins
  110328514 (Cd3d)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 110328514
NCBI-ProteinID: XP_021063579
Ensembl: MGP_PahariEiJ_G0015002
LinkDB
Position
10:40106063..40110645
AA seq 173 aa
MEHSGILTSLILATVLPQGSPFKIPVTEYEDKVFVNCNTSIMHLDGTVEGWFAKNKTLNL
GKGILDPRGMYMCNGTEEQAKMVSTVQVHYRMCQNCVELDSGTMAGVIIVDLIATLLLAL
GVYCFAGHETGRLSGAAEVQALVKNEQLYQPLRDREDAQYSRLGGNWPRNKRS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaacacagcgggattctgactagtctgatactggctactgttctcccccaagggagc
cccttcaagataccagtgacagaatatgaagacaaagtatttgtgaactgcaataccagc
atcatgcatctagatggaacagtggaaggatggtttgcaaagaataaaacactcaacttg
ggcaaaggcatcctggacccacgagggatgtatatgtgtaatgggacagaggagcaggcg
aagatggtgtctactgtacaagtccattaccgaatgtgccagaactgtgtggagctagac
tcaggcaccatggctggtgtcatcatcgttgacctcatcgccactctgctcctggctttg
ggagtctactgctttgcaggacatgagaccggaaggctttctggggctgccgaggttcaa
gccctggtgaagaatgagcagctgtatcagcctcttcgagatcgcgaagatgcccagtac
agtcgtctcggagggaactggccccggaacaagagatcttga

KEGG   Mus pahari (shrew mouse): 110328560
Entry
110328560         CDS       T05929                                 
Symbol
Cd3e
Name
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah05142  Chagas disease
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110328560 (Cd3e)
   04660 T cell receptor signaling pathway
    110328560 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    110328560 (Cd3e)
   04659 Th17 cell differentiation
    110328560 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110328560 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110328560 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    110328560 (Cd3e)
   05162 Measles
    110328560 (Cd3e)
   05169 Epstein-Barr virus infection
    110328560 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110328560 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    110328560 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110328560 (Cd3e)
CD molecules [BR:mpah04090]
 Proteins
  110328560 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 Ig_2 ITAM ig Ig_3 m04gp34like DUF5640 DUF6249
Other DBs
NCBI-GeneID: 110328560
NCBI-ProteinID: XP_021063640
Ensembl: MGP_PahariEiJ_G0015003
LinkDB
Position
10:complement(40124067..40134276)
AA seq 189 aa
MRWNTFWGVLGLSLLAVGTCQDDTEDIEYKVSISGTSVELTCPLESDDNLKWEKNDQILP
KKNDKLLVLEDFSEVEDSGYYVCYIEASKKNAYLYLKARVCENCVEVDLTTVAIIIIVDI
CITLGLLMVVYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAI
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcggtggaacactttctggggtgtcctgggcctcagcctcctagcagttggcacttgc
caggacgataccgaggacattgaatataaagtctccatctcaggaaccagtgtagagttg
acatgccctctagagagtgacgacaacttaaaatgggaaaaaaatgaccagatactgcct
aaaaagaatgataagctcctggtgctagaggatttctcagaagtcgaggacagtggctac
tatgtctgctacatagaagcctcaaagaaaaacgcatacctgtacctgaaagctcgagtg
tgtgagaattgtgtggaggtggacctgactacagtagccataatcatcattgttgacatc
tgtatcaccctgggcttgctgatggtcgtttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcagacccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactacgagcccatccgcaaaggccagcgggacctg
tattctggtctgaatcagagagcaatctga

DBGET integrated database retrieval system