KEGG   Mus pahari (shrew mouse): 110322295
Entry
110322295         CDS       T05929                                 

Gene name
Hhat
Definition
(RefSeq) protein-cysteine N-palmitoyltransferase HHAT isoform X1
  KO
K24678  protein-cysteine N-palmitoyltransferase HHAT [EC:2.3.1.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110322295 (Hhat)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     110322295 (Hhat)
SSDB
Motif
Pfam: MBOAT DAD CDP-OH_P_tran_2
Other DBs
NCBI-GeneID: 110322295
NCBI-ProteinID: XP_021054568
Ensembl: MGP_PahariEiJ_G0028293
LinkDB
Position
5
AA seq 493 aa
MLPGWELTLCLLVSLGFHFCSFYEVYKVSREHEEELDQEFELEMDTLFGGLKKDPTDFEW
NFWMEWGKRRLVWLFIGHMAVSQLATLLTKKHRPWIVMVYGMWACWCVLGAPGVVMVLLH
STIAFCVAQFRSVFLSWLCSLLLLSTLRLQSVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCRQPPSAQGASYSYPWLLTYVFYYPVFHNGPILNFPEFFRQMQQPELSSLQHS
FCILAKGLGRLLCWWWLAELMVHLMYMHALYSSIPLLESVSCWTLGGLALAQVLFFYVKY
LVLFGAPALLMRLDGLTPPPLPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPLGGSQRG
LLGTLLSTATTFAFVSYWHGSYEDLWCWAALNWLGVTVESGVRRLLETPCIRETLARHLS
PQARHRLHALLAACSTSMLILFNLVFLGGIQVGKTYWNRIFLQGWPWVTLSVLGFLYCYS
HVGIAWAQTYTVL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgctgcccgggtgggaactgactctctgcctccttgtttccttgggcttccacttctgc
tctttctatgaagtttacaaagtctccagagagcatgaagaggaactggaccaagaattt
gagctggagatggatactctatttggaggactgaagaaggacccgactgattttgagtgg
aacttttggatggaatgggggaagcggaggctggtgtggctcttcattggccatatggct
gtgtctcagttggccacgttactcacaaagaagcacagaccctggattgtcatggtctat
ggaatgtgggcctgctggtgtgtgctgggggctccaggcgtggtcatggtccttctccac
agcaccattgcgttctgcgtggctcagttccgatccgtgttcctgtcctggctgtgttct
ctccttctgctctccaccctaaggctgcaaagtgtggaggaagttaagagaaggtggtac
aagacagagaatgagtattacctgctgcagttcacgctcactgttcgctgcctgtactac
accagcttcagcctggagctgtgccggcagcctccgtctgcacagggtgcctcctattct
tacccgtggctgctgacctacgtcttctattatcccgtcttccacaatgggcccatcctt
aacttcccggagttcttcagacagatgcagcagccagagctcagctctctgcagcacagc
ttctgcattctagccaagggtctgggccgcctgctctgctggtggtggctggctgaactg
atggtacacctcatgtacatgcatgccctctacagcagcatccccctcctggagagtgtt
tcctgctggaccttaggaggactggcactggcccaagtgctcttcttctatgtgaagtac
ctggtgctcttcggtgccccggctctgctcatgcgcctggatggactcacaccaccaccc
cttccccgctgcgtgagcaccatgttcagttttaccgggatgtggaggtattttgatgtt
ggactacacaatttcttaatcaggtatgtgtatatcccactgggcgggtcccagcgtggc
ctgttggggacattgctttctactgcgacaacgtttgcatttgtgagctactggcatggc
agctatgaggacctctggtgctgggcagcactcaactggctgggagtcactgtggagagt
ggggtccggaggctgctagagacaccctgcatccgggagactttggcccggcacctctcc
ccacaagcccgccatcgactgcacgctctgctcgctgcctgctccacctccatgctcatc
ctcttcaacctggtgttcctcgggggaattcaagttggaaaaacctactggaacaggatc
ttcctgcaagggtggccatgggtgactctgtctgtcctgggattcctgtactgctattca
cacgtgggcattgcctgggctcagacatacacagttctttaa

DBGET integrated database retrieval system