KEGG   Mus pahari (shrew mouse): 110322312
Entry
110322312         CDS       T05929                                 
Name
(RefSeq) coagulation factor XIII B chain
  KO
K03906  coagulation factor XIII B polypeptide
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322312
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110322312
SSDB
Motif
Pfam: Sushi Sushi_2 AraC_binding
Other DBs
NCBI-GeneID: 110322312
NCBI-ProteinID: XP_021054589
Ensembl: MGP_PahariEiJ_G0027905
LinkDB
Position
5:113660125..113682455
AA seq 669 aa
MMTLRHLPFILLLILSEELYAEEKQCDFPTVENGRIAQYYYTFKSFYFPMSIDKKLSFFC
LAGYATERGKQEEQIRCTAEGWSPKPRCYKKCLKPDLRNGYVSDGKVLYKLQESMRYGCT
SGYKTTGGKDEEVVQCLSEGWSSQPSCRREQETCLAPELEHGNYSTTQRTFKVKDIVGYT
CTAGYYSAAGKQTGEAECQAHGWSLTPQCNKLMCSSLRLIENGYFHPVKQTYEEGDVVQF
FCHENYYLSGSDLIQCYNFGWYPESPICEGRRNRCPPPPVPLNSKIQQHSTTYRHGERVH
IECELNFVIQGSEELLCENGKWTEPPKCIEEKEKVACEQPPSVVNGVAQPHSEIYYSGDK
VTYTCGGGYSLRGSSTITCNRGRWTLPPECVENIENCKPPPDIANGVVADGLLASYTSGS
SVEYRCNEYYLLKGSETSRCEQGVWSSPPVCLEPCTIDVDHMNRNNIQLKWKYEGKILHG
DLIDFVCKQGYNLSPSIPLSEISAQCNRGDVRYPVCVRRESKGMCASPPVIRNGDIVSSA
AHTYENGSSVEYQCFENHFLQGSRNAYCVDGVWTTPPSCLEPCTLSFVEMDENYLQLKWK
FDNRPLILHGEYIEFMCKRDAYITETSIAGSVLRVQCDRGRLKYPKCIPRDRSLSFQEAL
RTRRQMEER
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgatgacgctgagacacttgccatttattcttttattaatcctctcagaagaactctat
gcagaagagaaacagtgtgattttcctactgtggaaaatggaaggattgcccaatattat
tatacatttaaaagcttttacttccccatgagcatagacaaaaaactatcattcttctgt
ttggctggctatgcaaccgaaagggggaagcaagaagagcaaatcaggtgcacagcagaa
ggctggtctccaaaaccaaggtgctacaaaaaatgtctgaagcctgacctaaggaatggc
tacgtctctgatggcaaagtactgtacaaacttcaagagagtatgcgttatggttgcact
tcaggatacaaaaccactgggggaaaggatgaggaggtggtccaatgtctttccgaaggg
tggtcttctcaaccgtcctgcaggagagaacaagagacatgtttggcccctgagttggag
catggaaattattccacgacgcagagaacattcaaagtgaaggacatagtgggttacaca
tgcactgcaggctactacagcgctgcagggaagcagactggggaagccgagtgccaggct
cacggctggtccctcacgccacagtgcaacaaattaatgtgctcttctttgagattaata
gaaaatggctactttcatcctgtaaagcaaacatatgaagaaggagatgtagttcaattt
ttctgtcatgaaaattactatctaagtggatctgatttaattcagtgctataactttggc
tggtatccagaatctcccatatgtgaaggaagaagaaatcgatgtcctcctccacctgtg
cctctaaattctaaaattcaacaacattcaacaacttaccgtcacggagaaagagtgcat
atagaatgtgagcttaattttgtgattcagggttcagaagaactactctgtgaaaatggg
aagtggacagaacctccaaaatgtattgaagaaaaggagaaggtagcctgcgagcaacca
ccctccgttgtgaatggtgttgcacagccacactctgagatttactacagtggggataaa
gtgacatacacgtgtggagggggctacagtctccgaggatcaagtacgataacttgcaat
cgtggccgatggacactgccccctgagtgtgttgaaaatattgagaattgtaagcctcct
cctgacatagcaaatggtgtggttgctgatgggttactggcaagttacacatcaggatct
tcagtggagtacagatgcaatgagtattacttattgaagggatcagaaacatctcgctgt
gaacaaggagtgtggtcatctccacctgtatgtttggagccatgcactattgatgtggat
cacatgaacaggaataacatacagttgaagtggaaatatgagggcaagattttacatgga
gacctaatagattttgtgtgtaaacagggatataacttgtcaccgtcaatcccattgtct
gagatatccgcgcagtgcaatagaggcgatgtgagataccccgtgtgcgttagaagagaa
tctaaagggatgtgtgcatctcctccagtgataagaaatggagatattgttagttcagca
gcccacacctatgaaaacggctcctcagtagaataccagtgttttgaaaatcatttccta
caagggtctcggaatgcctattgtgtagatggagtgtggactacaccaccatcgtgtcta
gagccttgcacattatcatttgttgaaatggatgagaattatttacagctgaaatggaaa
tttgacaacagaccgctcattctccatggagagtatattgaatttatgtgtaagagagat
gcatatataactgagacatctattgctgggtctgtacttcgagtgcagtgtgacagggga
aggctgaaataccctaagtgtattccaagagacaggagtctgtcctttcaggaagcatta
aggacccgaagacaaatggaagaaagataa

KEGG   Mus pahari (shrew mouse): 110333906
Entry
110333906         CDS       T05929                                 
Symbol
F13a1
Name
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110333906 (F13a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110333906 (F13a1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110333906 (F13a1)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core Arrestin_C
Other DBs
NCBI-GeneID: 110333906
NCBI-ProteinID: XP_021071342
Ensembl: MGP_PahariEiJ_G0019502
LinkDB
Position
16:complement(39926166..40097694)
AA seq 732 aa
MSDSPASTLGGRRAVPPNNSNAAEADLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVKELQSGKWGAKVIMNDDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTRRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKQDGTHVVEAVDATHIGKLIVTKQIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKSLNTEGVVKSRSDVTMNFDVENAVLGKDFKVTITF
QNNSSNLYTILAYLSGNVTFYTGVSKKEFKKESFEETLDPFSSKKKEVLVRAGEYMSHLL
EQGLLHFFVTARINESRDVLAKQKSVVLTIPKITIKVRGAVMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVMLPKRKMFREIRPNTTVQWEEVCRPWVSGPRKLIASMTSDSLRHVYG
ELNLQIQRRPTM
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcagatagtccagcaagcaccctcggggggaggcgagcagttccacccaataactcc
aacgcagcagaagcggaccttccgactgaggagctacagggcttggtgccaaggggtgtc
aacctgaaagattacctgaatgtcacagctgttcacctgttcaaggagagatgggacagt
aacaagatcgatcaccacacagacaaatatgacaacaataagttgattgtccgcagaggg
cagactttctacatccagattgacttcaatcgtccgtatgaccccaggaaggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaacaagggcacctacatcccagtg
cctgtagtgaaagagctgcaaagcggaaagtggggagccaaggttatcatgaacgacgac
cggtccgtgcggctttccgttcagtcttccccggaatgcatcgtggggaaattccgcatg
tatgttgcagtctggactccctatggcatcctgcgtactcgaagagacccagaaacagac
acatacattctcttcaatccgtggtgtgaagaggatgctgtgtatctggatgatgagaag
gaaagagaagagtacgtcctgaatgacatcggagtgatattttatggggacttcaatgac
atcaagagcagaagctggagctatggccagtttgaagacggcatcctggatgcttgcttg
tatgtgatggacaaagctgagatggacctttctggcagaggcaaccccatcaaagtcagc
cgagttggatcagcaatggtgaatgccaaggatgacgaaggtgttcttgttggatcatgg
gacaatgtttatgcctacggcatccctccatcagcctggacaggaagtgttgacattcta
ctagaatacagaagctcagaaacaccagtccgatatggccagtgttgggtttttgctggt
gtctttaacacatttttaagatgccttggaatccctgcgcgagtcattaccaattacttc
tcagcccatgacaatgatgccaatctgcaaatggacatcttcctggaagaagatgggaat
gtgagctccaaactcaccaaggattcagtgtggaactaccactgctggaatgaggcatgg
atgacaaggcctgaccttcctgtcggattcggaggctggcaagctgtggacagcacaccc
caggaaaacagtgatggcatgtaccgctgtggccctgcctctgtccaagccgtcaaacac
ggccatgtctgcttccagtttgatgccccatttgtttttgcagaggtcaacagtgatctt
gtttacatcacagctaagcaagatggcactcatgtggtggaagccgtcgatgccacccat
atcgggaagctaatcgtgaccaagcaaattggaggagatggcatgcaggatatcacggac
acttacaaatttcaagaaggccaagaagaagagagactggcccttgaaactgctctgatg
tatggagccaagaagagcctcaacactgaaggcgtggtcaaatcgaggtctgatgtgacc
atgaacttcgatgtggaaaatgctgtgctgggaaaggacttcaaagtgactatcaccttc
cagaacaatagctccaatctgtacaccatcttggcctatctttccggcaacgtcaccttc
tacactggggtctccaagaaagagttcaagaaggagtcctttgaagagacgctggatccc
ttttcctccaagaaaaaggaggtgctggtcagagctggcgaatacatgagccaccttctg
gaacagggcctcttgcacttcttcgtcacggcacgcatcaacgagtccagggatgtcctg
gccaagcaaaagtccgtagtgctgactatccccaagatcaccatcaaggtccgaggtgct
gtcatggttggctctgatatggttgtgactgttgagttcactaatcctttaaaagaaacg
ctacaaaatgtctggattcatttggatggtcctggagtgatgttacccaagaggaagatg
ttccgcgaaatccggcccaacaccactgtgcagtgggaagaagtctgtcggccttgggtc
tctggccctcggaagctgattgccagcatgaccagtgactccctgagacatgtgtatgga
gagctgaatctgcagattcaaagacgacctactatgtaa

DBGET integrated database retrieval system