KEGG   Mus pahari (shrew mouse): 110322354
Entry
110322354         CDS       T05929                                 
Symbol
Cd46
Name
(RefSeq) membrane cofactor protein
  KO
K04007  membrane cofactor protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05162  Measles
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322354 (Cd46)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    110322354 (Cd46)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322354 (Cd46)
   04090 CD molecules [BR:mpah04090]
    110322354 (Cd46)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110322354 (Cd46)
CD molecules [BR:mpah04090]
 Proteins
  110322354 (Cd46)
SSDB
Motif
Pfam: Sushi Collectrin
Other DBs
NCBI-GeneID: 110322354
NCBI-ProteinID: XP_021054654
Ensembl: MGP_PahariEiJ_G0028306
LinkDB
Position
5:complement(166842887..166877610)
AA seq 365 aa
MMAAPLMADSTHPRRRRKSYTFFWCSLGIYAEALLFLLSHLSDACELPPPFEAMELKGTP
KLYYAVGEKIEYKCKRGYLYLSPYLMIATCEPNHTWVPISDDGCIKVQCTMLQDPSFGKV
YFIDGSFSLGARAKFTCMEGYYLVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIK
NGTHTLTDINVFKYHEAVSYSCDPNPGPDQFSLVGTSMIFCAGQNTWSNSPPECKVVKCP
FPVLRNGRQISGAGENFSYQATVMFECVQGFYMEGSSMVVCSANNSWEPSIPKCLKGPKP
THPTKPPVYNYPGYPSLREGIFSQELDAWIIALTVITSIVGVFIICLIVLRYFEYRKKRN
VSAAR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgatggcggcgcctcttatggcagactcaacgcacccccgtcgtagaaggaagagctac
actttcttctggtgctccttgggcatctatgctgaggcccttctgtttctgctgtctcat
ttatctgatgcctgtgaactaccaccgccatttgaagctatggaactcaagggtacacct
aaactctattatgcagttggagagaaaatagaatataagtgtaaaagaggatacctatat
ctgtctccatacctgatgattgctacctgtgagccaaatcatacatgggttcctatttca
gatgatggttgtattaaagttcaatgtactatgttacaggacccttcatttggcaaagta
tacttcatagatggcagtttttcattgggtgctcgagctaaatttacttgtatggaaggt
tattacttagttggtatgtcagttctacactgtgtgcttaaaggtgatgatgaagcatac
tggaatggctatcccccacattgtgaaaagatttattgtttaccacctccaaaaataaaa
aatggaacacacacccttactgatataaatgtattcaaataccatgaagcagtaagttac
agttgtgatcctaacccagggccagatcagttttcccttgttggaacaagcatgatattc
tgtgctggccaaaacacctggagtaacagccctccagagtgtaaagtggtaaaatgtcca
tttccagtgctacgaaatggaagacagatatcaggagctggagaaaatttttcctatcaa
gcaacagtgatgtttgagtgtgtgcaaggattttacatggaaggcagtagcatggtggtc
tgcagtgctaataactcttgggagccatctatcccaaaatgtcttaaaggtcctaagcct
actcatcccaccaagcctccagtttataattatccaggatatcctagtctccgtgaagga
atatttagccaagaattagatgcatggattattgctttgactgttattacttcaattgtt
ggagtttttataatttgtctcattgtgctcaggtattttgagtacaggaagaaaagaaat
gtatctgcagcaagatga

DBGET integrated database retrieval system