KEGG   Mus pahari (shrew mouse): 110322514
Entry
110322514         CDS       T05929                                 
Symbol
Nfasc
Name
(RefSeq) neurofascin isoform X1
  KO
K06757  neurofascin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322514 (Nfasc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig Bravo_FIGEY V-set Ig_5 C2-set_2 BiPBP_C DUF4998
Other DBs
NCBI-GeneID: 110322514
NCBI-ProteinID: XP_021054852
Ensembl: MGP_PahariEiJ_G0027827
LinkDB
Position
5:complement(106813895..106987805)
AA seq 1448 aa
MRRLAARGAAGDAREVAAPGADIWDCARGWSRSSWRLTDLCALWQPGVFLPSADGSRASA
GVGKSRPNEAEKLSTVWKAHIERHKASGACGLGSGEQGLVLRMARQQAPPWVHIALILFL
LSLGGAIEIPMDPSIQNELTQPPTITKQSVKDHIVDPRDNILIECEAKGNPAPSFHWTRN
SRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSK
SPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLY
FSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTSSSQMV
LRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLA
SNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQ
SAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQ
LIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKMIRKEDQGI
YTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQLECRVKHDPSLKLTVSWL
KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQDLAKAYLTVLADQATPTN
RLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDDNNSPITDYVVQFEEDQFQPGVWHDH
SKFPGSVNSAVLHLSPYVNYQFRVIAVNEVGSSHPSLPSERYRTSGAPPESNPSDVKGEG
TRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETRETWNNVTVWGSRYVVGQTPVYVPYE
IRVQAENDFGKGPEPDTVIGYSGEDYPRAAPTEVKIRVLNSTAIGLQWNRVYSDTVQGQL
REYRAYYWRESSLLKNLWVSQKRQQASFPGDRPRGVVARLFPYSNYKLEMVVVNGRGDGP
RSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGILIGYTLRYVPFNGTKLG
KQMVENFSPNQTKFSVQRADPVSRYRFSLSARTQVGSGEAATEESPAPPNEATPTAAPPT
LPPTTVGTTGLVSSTDATALAATSEATTVPIIPTVVPTTVATTIATTTTTTAATTTTTTE
SPPTTTTGTKIHETAPDEQSIWNVTVLPNSKWANITWKHNFRPGTDFVVEYIDSNHTKKT
VPVKAQAQPIQLTDLFPGMTYTLRVYSRDNEGISSTVITFMTSTAYTNNQADIATQGWFI
GLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQ
GSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSP
VNAIYSLA
NT seq 4347 nt   +upstreamnt  +downstreamnt
atgcggcggctggcagcgagaggtgctgcaggggacgcgagggaagtggcggcgccggga
gcggacatctgggactgcgcccggggctggagccggagctcctggaggttgactgactta
tgtgcgctttggcagcctggagttttcttgccctctgccgacgggagcagagcctccgct
ggtgttgggaagagcaggccgaatgaggcagagaagctgagcactgtctggaaagcccac
atagagcggcacaaggcatcgggagcctgtgggctgggcagcggggagcagggcctggtg
ctgaggatggccaggcagcaggcaccaccctgggtccacatagccctcatcctcttcctc
ctcagccttggaggggccattgagattccgatggacccaagcattcagaatgagctgacc
caaccgccaactatcaccaagcagtccgtgaaggaccacatcgtggaccctcgagataac
atcctgattgaatgtgaagctaaaggcaaccccgcccccagttttcattggactcgcaac
agcagattcttcaacattgccaaggacccacgagtgtctatgaggaggagatctgggacc
ttggtgatcgacttccgcagtggtgggcggcctgaggaatacgaaggggagtaccagtgc
tttgcccggaacaaatttggcactgcgcttagcaaccgcatccgcctgcaggtgtccaaa
tctcccctgtggcccaaggaaaacctagaccccgtcgtggttcaagagggcgctcccttg
acactgcagtgcaaccccccacccggcctcccgtcccccgtcatcttctggatgagcagc
tccatggagcccatcacccaggacaagcgtgtctcccagggtcataacggggacctgtac
ttctccaacgtcatgctgcaggacatgcagaccgactacagctgcaacgcgcgcttccac
ttcacccacacaattcagcagaagaatcccttcaccctcaaggtcctcaccacccgagga
gttgcagaaagaacacccagcttcatgtatccccagggcacatcgagcagtcagatggtt
ctacgtggcatggacctgctgctggagtgcattgcctctggggtcccaacaccagacatt
gcatggtacaagaaaggtggggacctcccatctgacaaggccaagtttgagaactttaac
aaggctctgcgcatcaccaatgtctccgaagaggactctggggagtatttctgcctggcc
tccaacaagatgggcagcatccggcacacgatctcggtgagagtaaaggctgctccatac
tggctggatgagcccaagaacctgatcctggctcctggggaagatgggaggctggtatgc
cgagccaatgggaacccgaagccgaccgtgcagtggatggtgaatggagagcctttgcaa
tcggcaccacccaatcccaaccgtgaggtggccggagacactatcatcttccgggatact
cagatcagcagcagggcagtgtaccaatgtaacacatccaatgaacatggctacctgctg
gccaatgccttcgtcagcgtgttggatgtaccccctcggatgctgtctccccggaaccag
ctcatcagggtgatcctttacaaccggacacggctggactgtccgttctttgggtctccc
atcccaacactccgatggtttaagaatgggcaaggaagcaacctggatggcggtaactac
cacgtctatgaaaacggcagtctagaaatcaagatgattcgcaaagaggaccaaggcatc
tacacctgtgtggccaccaacatcctgggcaaagctgaaaatcaagtccgcctggaggtc
aaagaccccaccaggatctacaggatgcccgaggaccaggtggccaagaggggcaccacg
gtgcagctggagtgccgtgtgaagcacgacccctccttgaagctcacagtctcctggctg
aaggacgacgagccactctacattggaaacaggatgaagaaggaagacgactccctgacc
atctttggagtggcggagcgggaccagggcagttacacgtgcatggccagcaccgagctg
gaccaggacctggcaaaggcctacctcactgttctagctgatcaggccactccaactaac
cgtttggctgccctgcccaaagggcggccagacagacccagggacttggagctcactgac
ctggctgagaggagtgtaaggctgacctggatcccaggggatgacaacaacagccctatc
acagactacgtcgttcagtttgaagaggaccagttccaaccaggggtctggcatgaccac
tccaagttcccaggcagcgtcaactcagctgtcctccatctatccccgtatgtcaactac
caattccgagtcatcgctgtcaacgaggttgggagcagccaccccagccttccatccgag
cggtaccggaccagcggggcaccccctgaatctaatcccagtgatgtgaagggcgaaggg
acaagaaagaacaatatggagatcacatggacgcctatgaatgctacctctgcctttggc
cccaacctacgctacattgtcaagtggcgacggagagagacccgagagacttggaacaat
gtcacagtgtggggctctcgctacgtggtggggcagacacctgtctacgtaccctacgag
atccgagtccaggctgaaaatgattttgggaaaggccccgagcctgacaccgtcattggg
tactcgggagaagattatcccagggccgcgcccactgaagttaaaatccgagtcctgaac
agcacagccatcggccttcagtggaaccgagtctactctgacacggtccagggccagctc
agagagtatcgagcttactactggagggaaagcagtttgctgaagaacctgtgggtgtct
cagaagagacagcaggccagcttccctggtgaccgtccccggggcgtggtggcccgcctg
ttcccctacagtaactacaagctggagatggtggtggtcaatgggagaggtgacgggcct
cgaagtgaaaccaaggaattcaccaccccggaaggagtacccagtgcccccaggcggttc
agagtccgacaacccaacctggagaccatcaacctggagtgggaccacccagagcatccc
aacggaatcctgattggatacactctcagatacgtcccctttaatggaaccaaactgggg
aagcagatggtggaaaacttctcccccaatcagaccaagttctcggtgcagagagcagac
cccgtgtcgcgttaccgtttctccctcagtgccaggacgcaggtgggctctggtgaagca
gccacggaggagtccccagcacctccaaatgaagctactccaaccgcagctcctcccacg
ttacccccgactaccgtgggtaccacaggccttgtgagcagtactgatgctactgccctt
gctgccaccagcgaagccacaacagttcccatcatcccaaccgtcgtacctaccaccgtc
gccaccaccattgccacaactactacaaccactgccgccaccaccaccaccactacggag
agtcctcccactaccaccactgggactaagattcacgaaaccgcccccgacgagcagtcc
atttggaacgtcacagtgctccccaacagtaaatgggccaacatcacctggaagcacaat
ttcaggcctggaactgactttgtggttgagtacatcgacagcaaccatacgaaaaaaact
gtccctgttaaggcccaggcccagcctatacagctgacagacctctttcccgggatgacg
tacacgttgcgggtgtattcccgggacaacgagggcatcagcagtaccgtcatcaccttt
atgaccagtacagcttacaccaataaccaggcagacatcgccacccagggctggttcatc
gggctcatgtgtgccatcgcccttctggtgctgatccttctcatcgtctgcttcatcaag
aggagtcgcggtggcaagtacccagtgcgagaaaagaaggatgtccccttgggccctgaa
gaccccaaagaagaagatggctcatttgactacagtgacgaggacaacaagcccctgcag
ggaagccagacatctctggatggcaccatcaagcagcaggagagcgatgacagcctggtg
gactacggtgaaggcggcgagggccagttcaatgaagatggctcctttatcggccagtac
actgtcaaaaaggacaaggaggagacggagggcaacgagagctcagaggccacgtcgccg
gtcaatgccatctactcccttgcctga

DBGET integrated database retrieval system