KEGG   Mus pahari (shrew mouse): 110322592
Entry
110322592         CDS       T05929                                 

Symbol
Sele
Name
(RefSeq) E-selectin
  KO
K06494  selectin, endothelial cell
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04668  TNF signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110322592 (Sele)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322592 (Sele)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    110322592 (Sele)
   05143 African trypanosomiasis
    110322592 (Sele)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110322592 (Sele)
   05418 Fluid shear stress and atherosclerosis
    110322592 (Sele)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322592 (Sele)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110322592 (Sele)
   04090 CD molecules [BR:mpah04090]
    110322592 (Sele)
   04091 Lectins [BR:mpah04091]
    110322592 (Sele)
Cell adhesion molecules [BR:mpah04515]
 Selectins
  Selectin family
   110322592 (Sele)
CD molecules [BR:mpah04090]
 Proteins
  110322592 (Sele)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 4: Selectins
   110322592 (Sele)
SSDB
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 EGF_3
Other DBs
NCBI-GeneID: 110322592
NCBI-ProteinID: XP_021054947
Ensembl: MGP_PahariEiJ_G0028026
LinkDB
Position
5
AA seq 612 aa
MNASLFLSALAFVLLAGESTAWYYNASRELMTYDEASAYCQRDYTHLVAIQNKEEINYLN
SNLKHSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPK
DSGMWNDERCDKKKLALCYTASCTNASCSGHGECVETINSYTCKCHPGFLGPNCEQAVTC
KPQEYPDHGSLNCSHPFGLFSYNSSCSFSCKRGYLPSSMETTVRCMSSGEWSAPAPACHV
VECEALTHPAHGIRKCSSNPGSYPWNTTCAFDCVEGYRRVGAQNLLCTSSGIWDNEMPSC
KAVTCDAIPQLQNGFVSCSNSTAGELTFKSSCNFTCEQSFMLQGPAQVECSAQGQWTPQI
PVCKAFQCEALSAPQRGDMKCLPSASGPFQNGSSCEFSCEEGFELKGSRRLQCGLRGQWD
SKKPMCSVVKCDDVPRLQNGVMECAHATTGEFTYKSSCAFQCNEGFRLHGSAQLECTSQG
KWTQEVPSCQAVQCPSLDILGKMNMSCSGTAVFGTVCEFTCPDDWTLNGSAVLTCGATGR
WSGMPPTCEAPASPTHPLVVALSTAGTSLLTLSSLLYLLMKYFRKKAKKFVPASSCQSLQ
SFGNYHVPSYNV
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaatgcctcactctttctctctgctctcgcttttgttctccttgctggagagagcaca
gcttggtactataatgcctccagggagctcatgacgtatgatgaagccagtgcgtattgt
cagcgggactacacacatctggtggcaattcagaacaaggaagagattaactacctaaac
tccaatctgaaacattcaccaagttactactggattggaatcagaaaagtcaataacgta
tggatctgggtggggacccagaagcccctgacagaggaagctaagaactgggctccaggt
gaaccaaacaacaagcaaagaaatgaggactgtgtagagatctacatccaacgacccaaa
gactcgggcatgtggaatgacgagagatgtgacaaaaagaaactggctctgtgctacaca
gcttcgtgtaccaatgcatcctgcagtggtcatggtgaatgtgtagagaccatcaatagt
tacacctgcaagtgccaccctggtttcctaggacccaactgtgagcaagctgtgacttgc
aaaccacaggaataccctgaccatggaagcctgaactgctcccacccattcggccttttc
agctataattcctcctgctccttcagctgtaagaggggctacctgcccagcagcatggag
accaccgtgcggtgtatgtcctctggagagtggagtgcgcctgctccagcctgccatgtg
gttgaatgcgaagctttgacccaccctgcccacggaattaggaaatgttcctcaaatcct
ggaagctacccatggaacacgacgtgcgcgtttgactgtgtggaagggtacaggcgagtt
ggagctcagaatctactgtgtacctcatccggcatctgggacaatgagatgccatcgtgc
aaagctgtgacctgtgacgccatccctcagcttcagaatggctttgtgagctgtagcaac
tcaacagctggagaactcacctttaagtcatcctgtaacttcacctgtgagcagagtttc
atgttgcagggaccagcacaggttgaatgcagcgcacaagggcagtggacaccacaaatc
ccagtgtgcaaagctttccagtgtgaagccttatctgcgccacagcgaggcgacatgaaa
tgtcttcccagtgcttctgggcctttccaaaatgggtccagttgtgagttctcctgtgaa
gaaggatttgaattgaagggatcgagaaggcttcagtgtggtctgagagggcagtgggat
agcaagaagcccatgtgttcagttgtgaaatgtgatgatgtccctcggctccagaatggt
gtcatggagtgtgctcatgctactactggggaattcacctacaagtcctcatgtgccttt
caatgcaacgagggctttagattgcatggctcagctcaacttgagtgcacatcccaggga
aagtggacccaggaagtcccctcctgccaagcagtacaatgtccaagccttgacattctg
ggaaagatgaacatgagctgcagtgggacagcagttttcggcacagtgtgtgaatttaca
tgtcctgatgattggacactcaatggatctgcagttctgacatgtggtgccacgggacgc
tggtctgggatgccgcctacctgtgaagccccggccagccccacccatcccttggtagtt
gcactttctacggcaggaacctcactcctgacattgtcctcattgctctacttgttgatg
aaatactttcggaagaaagcaaagaaatttgttcctgctagcagctgccaaagccttcaa
tcgtttggaaactaccatgtgccttcttacaacgtctag

DBGET integrated database retrieval system