KEGG   Mus pahari (shrew mouse): 110323027
Entry
110323027         CDS       T05929                                 

Gene name
Patj
Definition
(RefSeq) inaD-like protein isoform X1
  KO
K06092  InaD-like protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110323027 (Patj)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110323027 (Patj)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110323027 (Patj)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2
Other DBs
NCBI-GeneID: 110323027
NCBI-ProteinID: XP_021055707
Ensembl: MGP_PahariEiJ_G0028521
LinkDB
Position
6
AA seq 1828 aa
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQL
KGQLSHIPSGCSANFDFSRKGLLVFTDGSITNGNAHRPCSNVSASELLPWTQMSGSEAFN
SVIQQMAQGRHVEYIDIERPSTGGLGFSVVALRSQSLGLIDIFVKEVHPGSVADRDHRLK
ENDQILAINDTPLDQNISHQQAIALLQQATGSLRLVVAREVGHTQGRASTSSADTTLPET
VCWGHTEEVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPASLPVALPAVASRTLDSDNSP
FETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVA
VDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSLSASPFEQSSSRETVAEPPKVPELT
ASLKPETNLSMEAEEIGERLDNLKNDTVQALEKPDVYPEKVPGSPENELKSRWENLLGPD
YEVMVATLDTQIADDEELQKYSKLLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLNLL
QPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTMEPALLE
AEVDHSVDVNTEDDDDDGELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPTRSVIVIR
SLVADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKAVPPGAVHLGICKPLVEDE
KEEHFSLHSNNNGDNSEPPETVHETHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQY
QQKDMDSSSEAWEMHEFLSPPLEGRGEEREMLVDEEYELYQDHLRAMESNPPPAHIREAT
PASPLLELQAGTQWLHVNLSGGEMLECHDAESMMSACPQEMQQYSYSTADMMEETFGLDS
RPPIPSSEGNCQHSRFDDMEHLHSVPSSSLDLGMMIASDLPGPGVLVDLPAVAQRREQED
LPLYRLPSAHIVTKPSSHMGLVSSRHANAACELPEREEGEGEETPNFSHWGPPRIVEIFR
EPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDL
QNASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPTVNNKGKTPATNQDQNTQERKAKRHG
TAPPPMKLPPPYRAPSADMEESEEDCALTDKKIRQRYADLPGELHIIELEKDKNGLGLSL
AGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPTR
VKLVFIRNEDAVSQMAVSPFPEPSHSPSPAEDLGGTEPVSSEEESSADAKHLPEPESSKP
EDLSQVVDDNMVAEQQKASESPDSAACQIKQQTYSTQVSSSSQGIPSSPAPLCQSAQADV
TGSGNFQAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEG
AAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYRDEAQYRDEENLEV
FLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHA
SQETVATILKCVQGLVQLEIGRLRAGSWAASRKTSQNSQGDQHSAHSSYRPSFAPVITSL
QNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGISIAGGKGSPLGDIPIFIAMIQASG
VAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAIATQLEM
MSAGSQLASPTADRHPEDTEEQLQRMAD
NT seq 5487 nt   +upstreamnt  +downstreamnt
atgcctgaaaaccctgctgcagagaaaatgcaggtcctgcaggtcctggatcgcctgaga
gggaagctgcaggagaagggagacacgacgcagaacgagaagctgtctgcgttttatgag
acgctgaagagccctctcttcaaccagatccttacactgcagcagtccatcaagcagctg
aagggacagcttagccatatcccctcaggttgttcagccaactttgacttttctcgaaag
ggcttgctagtgttcacggatggttccattacaaatgggaatgcccacaggccttgtagt
aacgtgtctgcatctgaattgttgccctggactcaaatgtcaggaagtgaagcctttaac
tcagtcattcagcagatggctcagggccggcacgttgagtatatagatattgaacgtcct
tcaactggaggccttggattcagtgtggtggctctgagaagccaaagcctgggattaatt
gatatctttgtgaaggaagtccatcccgggagtgtagcagacagagatcacagattgaag
gaaaatgaccagattttggccattaatgacaccccattggatcagaatatttcccatcag
caggcgattgcattactacaacaagccactggatctctgcggcttgttgtggccagggaa
gtgggccacacacagggccgagcatccaccagctcagctgatacaactctgccagaaacg
gtgtgttggggccacacagaagaggttgaactcattaatgatggctctggattaggtttt
gggatagttggagggaaatccagcggcgtggttgtgaggactattgttcctggaggactg
gcagaccgagatggaagactacagacaggggatcacatcttgaagattggtggtacaaat
gtacaaggaatgaccagtgaacaagttgctcaagtgctaaggaactgtgggaattcagtg
aggatgctggtggccagagaccctgttggtgaaattgcagtaacacctcctactcctgca
tccttacctgttgccctgcctgctgtagcctcaaggacccttgattctgacaattctcct
tttgaaacttacaatgttgaacttgttaaaaaagatggacagagtcttgggattagaatt
gttggctatgttggaacagctcatccaggggaagcttccgggatttatgtgaaaagtata
attccaggcagcgctgcgtaccacaatggccaaattcaagtgaatgataaaattgtggct
gtggatggtgtgaatattcagggttttgctaatcaggatgttgttgaagtattgcggaat
gcagggcaggtggtacacctaacccttgttcgaaggaaaacatctttatctgcttctccg
tttgaacagtcttcaagtagagaaactgttgcagaaccacctaaagtaccagaactaaca
gcatccctgaaaccagaaactaatttgagtatggaagcagaggaaatcggagaaagactg
gataatctaaaaaacgacactgtacaagccttagaaaaaccagatgtatatccagagaaa
gttccgggctctccagaaaatgagctgaaatccagatgggaaaacctattgggcccagat
tatgaagtaatggtagccactttggacactcagattgcagatgatgaggagctgcagaaa
tactcaaagctcctgcctatccatacgctcaggcttggtatggaagtcgactccttcgat
gggcaccactatatctcctcagttgctcctgggggtcctgtggataccctgaacctcctt
cagccagaggatgaacttcttgaggtcaacggcatgcagctttatgggaagtctcgccga
gaagccgtctccttccttaaagaagtgcccccaccgttcaccttggtctgctgccgcagg
ttgtttgatgatgaggcctcagttgacgagccaagaaccatggagcctgctcttcttgag
gccgaggttgaccacagtgtagatgtcaacactgaagatgatgatgatgatggagaatta
gccctgtggtctcctgaagtcaagactgtggagctggtgaaagactgcaaaggcttagga
ttcagcattctggattatcaggaccccctggatcccacacggtcagtgatcgtgattcgc
tccttggtggcagatggtgtagcggaaagaagtggagaacttttacctggagatcgcctc
gtctctgtcaatgagttctctttggacaatgccactcttgctgaggctgtggaagtgttg
aaggctgtacccccaggtgctgtgcaccttggcatctgtaagcctctggtggaagatgag
aaggaagaacattttagtttacattcaaacaacaatggtgacaacagtgagcctccagag
actgttcatgagacccactcgtctttaatccttgaggcgccccagggatttagagatgaa
ccatatcttgaagaacttgtggatgaaccttttctagatttgggaaagtctttgcagtac
caacaaaaagacatggacagcagctcggaagcctgggaaatgcatgagttcctgagccct
ccgctggagggcaggggtgaggagagagagatgcttgtagatgaggaatatgaactttat
caagatcacctccgggccatggagtcgaacccaccaccagcacacattcgggaggccact
cctgcatctcccttgctggagctccaggctggcacacagtggctacatgttaacctctca
ggaggcgaaatgctagagtgtcacgatgcagagtccatgatgagtgcctgtccccaggag
atgcagcagtatagctacagcactgcagacatgatggaagaaacatttggccttgattcc
cggccccccataccgtcctctgaaggaaattgtcaacacagcagatttgatgacatggaa
caccttcattcggtaccgagcagcagcctggatttaggcatgatgattgcaagtgacctg
ccaggtcccggtgtgcttgtcgatcttccagccgttgcccaaagaagagaacaggaagat
ttgcctctgtaccgactccccagtgcccacattgtcaccaagccttcatcacacatggga
ctggtgtcttcacgacatgcaaatgctgcatgtgaactaccagagagagaggaaggtgaa
ggagaggagacaccaaacttcagccactggggtccaccaagaattgttgaaatttttaga
gaacctaatgtgtctcttggcatcagcattgttggtggacaaacagttataaaacgcctc
aagaatggagaggagctcaaggggatattcatcaaacaagtgttggaggacagtcctgca
gggaagaccaatgcgctcaaaactggagataaaattcttgaggtgtctggtgtagacctg
cagaatgcctcacatgcagaagccgtggaggcaatcaagagtgcgggaaaccctgtggta
ttcgtggtacagagcctgtcatccacccccagggtcatcccaactgtgaataacaaaggc
aaaacacctgccacgaaccaggatcaaaacactcaagaaaggaaagctaagaggcacgga
acagctccacctccaatgaagctgcccccgccttacagagctccatctgcagacatggag
gaaagtgaagaagactgtgccctgaccgacaagaagatcaggcaaagatatgcagacctg
ccgggagaattacacattatcgaactggaaaaggacaagaatggactggggctcagtctc
gctggcaataaggacaggtcacgaatgagcatcttcgtggtggggattaatccggaggga
cctgctgctgcagacggacggatgcggattggagacgagctgctagagataaacaatcag
attctttatggaagaagtcatcagaatgcatctgccatcattaagaccgccccgaccagg
gtcaaactggttttcattagaaacgaagatgcagtcagtcagatggccgtctctcccttc
ccggagccatcacattccccatcgcctgctgaggatctgggtggcactgaacctgtcagc
agtgaggaggagagcagtgcggatgctaaacacctgcctgaaccagaaagctccaaaccg
gaagacctgtcccaggtggttgatgacaacatggtggcagagcagcagaaggcatcggag
tcacctgacagtgctgcctgtcagataaaacagcagacatattcaacacaagtctcctcc
agctcacaaggtatcccatcatcaccggctccattgtgtcagtcagcacaagcagacgtc
acaggctctggtaacttccaggctccgctctcggtggaccctgcaacatgtcccattgtc
cctggccaggaaatgatcatagaaatatccaaggggcgctcggggcttgggctcagcatt
gttggaggaaaagacacacctttggatgctatagttatccatgaagtctatgaagaaggt
gcagcagccagagatggaagattatgggctggagaccagatattagaggttaatggggtt
gatctgaggagctccagccatgaagaagccatcacagccctgaggcagaccccccagaag
gtgcggctggtggtatacagagatgaagcacagtacagagatgaggagaacttggaggtg
ttccttgtggatctgcagaagaagactggccgaggactaggcctgagcattgttgggaaa
cggagtggaagcggagtgtttatttccgacattgtgaaaggcggggccgcagacctcgat
gggaggttaattcgaggagaccagatcttgtctgtgaatggagaagacatgagacacgcc
tcacaggagacagtggccaccatcctgaagtgtgtccagggtcttgtccagctggagatt
gggagactccgtgccggttcctgggccgcctctcggaagacctcgcagaacagtcagggg
gatcagcacagtgcacacagcagctatcggccttcctttgccccagtcatcaccagccta
caaaacctggttggcacaaaaagatcttcagatcctccccagaaatgcacagaggaagaa
ccaaggactgttgagataatcagagagctcagcgatgccctcgggatcagtatcgctgga
ggaaaaggaagtcctttaggagatatccccatatttattgccatgattcaggccagtgga
gtggctgcacgtacccagaagcttaaggttggagatcggattgtgagcattaatggacaa
cctctggatggactgtctcacacagatgccgttaatctactgaagaatgccttcgggcgc
attatcctgcaggttgtggcagataccaacataagtgccatagcgacccagctggaaatg
atgtctgcaggctcccagcttgcctctccgactgccgaccgacatccggaagacacagag
gagcagctgcagaggatggctgattaa

DBGET integrated database retrieval system