KEGG   Mus pahari (shrew mouse): 110323075
Entry
110323075         CDS       T05929                                 

Gene name
Ptch2
Definition
(RefSeq) protein patched homolog 2 isoform X1
  KO
K11101  patched 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110323075 (Ptch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323075 (Ptch2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110323075 (Ptch2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 110323075
NCBI-ProteinID: XP_021055792
Ensembl: MGP_PahariEiJ_G0028681
LinkDB
Position
6
AA seq 1182 aa
MVRPLSLGELPPSYTPPARSSAPHILAGRLQAPLWLRAYFQGLLFSLGCKIQKHCGKVLF
LGLVAFGALALGLRVAVIETDLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAH
QEGGNVLTPEALDLHLQAALSASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLG
GTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASMVLQAWQRRFV
QLAQEALPANASQQIHAFSSTTLDDILRAFSEVSTTRVVGGYLLMLAYACVTMLRWDCAQ
SQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTK
APPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAALVPIPALRAFSLQAAIVVGCNFA
AVMLIFPAILSLDLRRRHRQRLDVLCCFSSPCSAQVIQMLPQELGDRAVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLLSPTSDPLGSELYSPGGSTRDLLSQEEGTGPKAACRP
LLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRSWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGNAQEPLDFSQLT
TRKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
AAQPLEFAQFPFLLHGLQKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALFLLSPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTSHGSRNLRAASALEQTFAPVTDGAVSTLLGLLMLAGSN
FDFIIRYFFVVLTVLTLLGLLHGLLLLPVLLSVLGPPPQVVQVYKESPQTLSSTAPQRGG
LRWDMPPTLPQSFARVTTSMTVALHPPPLPGAYVHPASEEPT
NT seq 3549 nt   +upstreamnt  +downstreamnt
atggttcggccactgtcccttggagagctacctcccagctacacacctccagctcggtcc
tccgcacctcatatcctagctgggaggctgcaggctccactctggcttcgtgcttacttc
caaggtctactcttctccctggggtgcaagatccagaaacactgcggcaaagtgctcttc
ctgggactggtggcctttggggctctggcactgggtctccgagtggctgtaattgagaca
gacctagaacagctctgggtagaagtgggcagcagagtgagccaggagctgcactacacc
aaggagaagctgggggaagaggctgcgtacacctcccagatgttgattcagactgcgcac
caggaggggggaaacgtcctgacccccgaggcacttgacttgcacctccaggcggcgctc
tcggccagtaaagtacaagtatctctttatgggaaatcctgggatttgaacaagatctgc
tacaaatcaggggttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccctgtgtgatcctcaccccacttgactgcttctgggaaggagccaaactccaaggg
ggctctgcctacttgccgggtcgccctgatatccagtggaccaacctggaccctcagcag
ctgctcgaggaactgggcccctttgcctctctggagggcttccgggagctgctggacaag
gcacaggtgggccaggcctatgtggggcgaccctgtctggaccctgatgacccccactgt
ccacctagcgctcccaaccgtcacagcaggcaggctcccaatgtggctcaggagctgagt
gggggctgccatggcttctcccacaagttcatgcactggcaggaggaactgctacttggg
ggcacagccagagatctccaaggacagctgctgagggcagaggctttgcagagcaccttc
ctgctgatgagtccccgtcagctgtatgagcacttccggggcgactaccagacacacgac
atcggctggagcgaggagcaggccagcatggtgctgcaggcctggcagaggcgctttgtg
cagctagcccaggaggctctgccagccaacgcgtcccagcagatccatgccttctcctcc
accaccctggatgacatcctgcgcgcgttctctgaagtcagcaccacccgtgtggtagga
ggctatctgcttatgttggcctatgcctgtgtaaccatgctacggtgggattgcgcccag
tcccaaggtgctgtaggccttgctggggtattgctggtggccctggcggtggcctcgggt
cttgggctttgtgccctacttggcatcactttcaatgctgccactactcaggtgctgccc
ttcttggctctgggcatcggcgtggatgacattttcctactggcacatgccttcacaaag
gccccacccgacacccctcttccagagcgtatgggtgagtgtttgaggagcacgggcacc
agcgtggcactcacatccgtcaacaacatggtcgccttcttcatggctgccctggttccc
attcctgcgctgcgggccttctccctgcaggcagccatagtggtcggctgcaacttcgca
gcggtaatgctcatctttccggccatcctcagcctcgacctgcgcaggcgccaccgccag
cgcctggacgttctctgctgcttttctagcccctgctccgctcaggtcattcagatgctg
ccccaggagctaggggacagagcggtaccagtgggcattgctcacctgactgccaccgtg
caagccttcacccattgcgaagccagcagccagcatgtagtcaccattttgcctcctcaa
gcccacctgctgtctccaacttctgacccactgggctctgaactctacagccctggaggg
tctacgcgggaccttctcagtcaggaggaggggacagggccaaaggcagcctgcaggccc
ctgctctgcgcccactggactctcgcccattttgcccgctatcagtttgcacctttactg
ctccagactcgagccaaggccctggtgttgctgttctttggggctcttttgggcctgagc
ctctatggagccaccttggtacaagatgggctggccctgacagatgtggtccctcggggc
accaaggaacatgctttcctgagcgcccagctcaggtacttctccctgtatgaggtggct
ctggtgacacagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggctgtgctgcccccgcctgccacccaggcaccccgcacc
tggcttcactactaccgcagctggctacaaggtatccaggctgcatttgaccaagactgg
gcttctgggcgcatcacccgccactcttaccgcaacggctcggaagatggcgccctggcc
tacaagctgctcatccaaaccgggaatgcccaggagcctctggatttcagccagctgacc
acaaggaaactggtggacaaggagggactcattcccccagagctcttctacatggggcta
accgtgtgggtgagcagcgaccccctgggcctagcagcctctcaggccaacttctacccc
ccacctccagagtggcttcacgacaaatacgataccaccggggagaaccttcgcatcccg
gcagcccagcccttggagtttgcccagttccccttcctgctgcatggactccagaagacg
gcagactttgtagaagccatcgaaggggcccgggcggcatgcacagaggcaggccaggca
ggggtgcatgcctaccccagtggctcccccttcctcttctgggagcagtatctgggtctt
cggcgctgcttcctgctggcggtctgcatcttgctggtgtgcaccttcctcgtctgtgcc
ctgtttctactcagcccgtggacagctggcctcatagtgctggtcctggcgatgatgact
gtggagctctttggtatcatgggattcctgggcatcaaactgagtgccatccccgtggta
atcctcgtggcctctgtaggcattggtgttgaattcacagttcacgtggctctgggtttc
ctgaccagccatggtagccggaacctgcgggctgccagcgctctggaacagacctttgcc
cctgtgactgatggagctgtctccacattgctgggtctgctcatgcttgctggttctaac
ttcgacttcatcataaggtacttctttgtggtgctgacggtgctgacactcctgggcctg
ctccacggactgctgctgctgcccgtgctgctctctgtcctaggccccccaccacaggtg
gtgcaggtatacaaggagagtccacagaccctaagctccacagcgccacagagaggtggg
ctcaggtgggacatgccccccaccctgccccagagttttgccagagtgactacctccatg
actgtggccctccacccaccacctctgcctggagcgtatgtccacccagcctccgaggag
cccacgtag

KEGG   Mus pahari (shrew mouse): 110333595
Entry
110333595         CDS       T05929                                 

Gene name
Ptch1
Definition
(RefSeq) protein patched homolog 1
  KO
K06225  patched 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04360  Axon guidance
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110333595 (Ptch1)
   04024 cAMP signaling pathway
    110333595 (Ptch1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110333595 (Ptch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333595 (Ptch1)
   05205 Proteoglycans in cancer
    110333595 (Ptch1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110333595 (Ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 110333595
NCBI-ProteinID: XP_021070861
Ensembl: MGP_PahariEiJ_G0019698
LinkDB
Position
16
AA seq 1434 aa
MASAGNAAGALGRQAGGGRRRRTGGPHRAAPDRDYLHRPSYCDAAFALEQISKGKATGRK
APLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGG
RVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYN
RQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPL
RWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNST
KPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYE
HFRGYDYVSHINWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQKVLSFTTTTLDDILKSF
SDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGIS
FNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSIS
NVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF
TSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITMQSTVQLRTEYDPHTHV
YYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSS
FAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQ
FKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPQMWLHYFRDWLQG
LQDAFDSDWETGRIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGII
NPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQF
PFYLNGLRDTSDFVEAIEKVRVICNNYTSLGLPSYPNGYPFLFWEQYISLRHWLLLSISV
VLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGV
EFTVHVALAFLTAIGDKNHRAMLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFA
VLAILTVLGVLNGLVLLPVLLSFFGPCPEVSPANGLNRLPTPSPEPPPSVVRFAVPPGHT
NNGSDSSDSEYSSQTTVSGLSEELRQYEAQQGAGGPAHQVIVEATENPVFARSTVVHPDS
RHQPPLNLRQQPHLDSGSLSPGRQGQQPRRDPPREGLRPPPYRPRRDAFEISTEGHSGPS
NRDRSGPRGARSHNSRNPTSTAMGSSVPSYCQPITTVTASASVTVAVHPPPGPGRNPRGG
PCPGYESYPETDHGVFEDPHVPFHVRCERRDSKVEVIELQDVECEERPWGSSSN
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggcctcggctggtaacgccgccggggccctgggcaggcaggccggcggcgggaggcgc
agacggaccgggggaccgcaccgagccgcgccggaccgggactatctgcaccggcccagc
tactgcgacgccgccttcgctctggagcagatttccaaggggaaggctactggccggaaa
gcgccgctgtggctgagagcgaagtttcagagactcttatttaaactgggttgttacatt
caaaagaactgcggcaagtttttggttgtgggtctcctcatatttggggccttcgctgtg
ggattaaaggcagctaatctcgagaccaacgtggaggagctgtgggtggaagttggtgga
cgagtgagtcgagaattaaattatacccgccagaagataggagaggaggctatgtttaat
cctcaactcatgatacagactccaaaagaagaaggcgctaatgttctgaccacagaggct
ctcctgcaacacctggactcagcactccaggccagtcgtgtgcacgtctacatgtataac
aggcaatggaagttggaacatttgtgctacaaatcaggggaacttatcacggagacaggt
tacatggatcagataatagaatacctttacccttgcttaatcattacacctttggactgc
ttctgggaaggggcaaagctacagtccgggacagcatacctcctaggtaagcctccttta
cggtggacaaactttgaccccttggaattcctagaagagttaaagaaaataaactaccaa
gtggacagctgggaggaaatgctgaataaagccgaagttggccatgggtacatggaccgg
ccttgcctcaacccagccgacccagattgccctgccacagcccccaacaaaaattcaacc
aaacctcttgatgtggcccttgttttgaatggtggatgtcaaggtttatccaggaagtat
atgcattggcaggaggagttgattgtgggtggtactgtcaagaatgccactggaaaactt
gtcagcgctcacgccctgcaaaccatgttccagttaatgactcccaagcaaatgtatgaa
cacttcaggggctacgactatgtctctcacatcaactggaatgaggacagggcagctgcc
atcctggaggcgtggcagaggacttacgtggaggtggttcatcaaagtgtcgccccaaac
tccactcaaaaggtgctttccttcaccaccacgaccctggacgacatcctaaaatccttc
tctgatgtcagtgtcatccgagtggccagtggctacctactgatgcttgcctatgcctgt
ttaaccatgctgcgctgggactgctccaagtcccagggtgcagtggggctggctggcgtc
ctgttggttgccctgtcagtggctgcaggattgggcctctgctccttgattggcatttct
ttcaatgctgcgacaactcaggttttgccattccttgctcttggtgttggtgtggacgac
gtcttcctcctggcccatgcattcagtgaaacaggacagaataagaggattccgtttgag
gacaggactggggagtgcctcaagcgcacgggagccagcgtggccctcacctccatcagc
aatgtcaccgccttcttcatggctgcgttgatccctatccctgccctgcgcgcattctcc
ctccaggctgctgtggtggtggtattcaattttgctatggttctgctcatttttcctgca
attctcagcatggatttatacagacgtgaggacagaagactggatattttctgctgtttc
accagtccctgtgtcagcagggtgattcaagttgaaccacaggcctacacagagcctcac
agtaacacccggtacagccccccacccccgtacaccagccacagcttcgcccacgaaacc
cacatcactatgcagtccaccgttcagctccgcacagagtacgaccctcacacacacgtg
tactacaccaccgccgagccacgctccgagatctccgtacagcctgtcactgtcacccag
gacaacctcagctgtcagagccccgagagcaccagctccaccagggacctgctttcccag
ttctcagactccagcctccactgccttgagcccccctgcaccaagtggacgctctcttcg
tttgcagagaagcactatgcccctttcctcctgaaacccaaagccaaggttgtggtgatc
cttcttttcctgggcttgctgggagtcagcctttatgggaccacccgagtgagagacggg
ctggacctcacggacattgttccccgggaaaccagagagtatgacttcatagctgcccaa
ttcaagtacttctctttctacaacatgtatatagtcacccagaaagcagactacccgaat
atccagcacctactttacgaccttcataagagtttcagcaatgtgaagtatgtcatgctg
gaggagaacaagcaacttccccagatgtggctgcactacttcagagactggcttcaagga
cttcaggatgcatttgacagtgactgggaaactgggaggatcatgccaaacaattataaa
aatggatcagatgacggggtcctcgcttacaaactcctggtgcagacgggcagccgagac
aagcccatcgacattagtcagttgactaaacagcgtctggtggacgcagatggcatcatt
aatccgagcgctttctacatctacctgacggcttgggtcagcaacgaccctgtagcttac
gctgcctcccaggccaacatccggcctcaccgaccagagtgggtccacgacaaagccgac
tacatgccagagaccagactgagaatcccagcagcagagcccatcgagtacgcacagttc
cctttctacctcaacggcctacgagacacctcagactttgtggaagccatagaaaaagtg
agagtcatctgtaacaactatacgagcctgggactgcccagctaccccaatggctacccc
ttcctgttctgggagcagtacatcagcctgcgccactggctgctgctatccatcagcgtg
gtgctggcctgcacgtttctagtgtgcgcagtcttcctcctgaacccctggacggccggg
atcattgtcatggtcctggctttgatgaccgttgaactctttggcatgatgggactcatt
gggatcaagctgagtgctgtgcctgtggtcatcctgattgcatctgttggcatcggagtg
gagttcaccgtccatgtggctttggcctttctgacagccattggggacaagaaccacagg
gctatgctcgctctggagcacatgttcgctcccgttctggacggtgctgtgtccactctg
ctgggtgtcctgatgcttgcagggtccgaattcgatttcattgtcagatacttctttgcc
gtcctggccattctcaccgtcttgggggttctcaatggactggtcctgctgcctgttctc
ttatccttctttggaccgtgtcctgaggtgtctccagccaatggcctaaaccgactgccc
actccttcgcctgagccgcccccaagtgtagtcaggtttgccgtgcctcctggtcacacg
aacaatgggtctgattcctcggactcggagtacagctctcagaccacagtgtctggcctc
agtgaggagctcaggcaatacgaagcccagcagggcgccggaggtcctgcccaccaagtg
attgtggaagccacagaaaaccctgtctttgcccggtccactgtggtccatccggactcc
agacatcagcctcccttgaaccttcggcaacagccccacctggactctggctccttgtcc
cctggacggcaaggccagcagcctcgaagggatccccccagagaaggcttgcggccgccc
ccttacagaccgcgcagagacgcttttgaaatttctactgaagggcattctggccctagc
aatagggaccgctcagggccccgcggggcccgttctcacaactctcggaacccaacgtcc
accgccatgggcagctctgtgcccagctactgccagcccatcaccactgtgacggcttcc
gcttctgtgactgtcgctgtgcatcccccgccaggacctgggcgcaacccccgaggggga
ccctgtccaggctatgagagctaccctgagactgatcacggggtgttcgaggatccccat
gtgccttttcatgtcaggtgtgagaggagggactcaaaggtggaggtcatagagctacag
gacgtggaatgtgaggagaggccgtgggggagcagctccaactga

DBGET integrated database retrieval system