KEGG   Mus pahari (shrew mouse): 110323460
Entry
110323460         CDS       T05929                                 
Name
(RefSeq) calreticulin-like isoform X1
  KO
K08057  calreticulin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04145  Phagosome
mpah04612  Antigen processing and presentation
mpah05142  Chagas disease
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110323460
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110323460
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110323460
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110323460
   05170 Human immunodeficiency virus 1 infection
    110323460
   05168 Herpes simplex virus 1 infection
    110323460
   05163 Human cytomegalovirus infection
    110323460
   05169 Epstein-Barr virus infection
    110323460
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110323460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110323460
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mpah04091]
    110323460
Chaperones and folding catalysts [BR:mpah03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   110323460
Lectins [BR:mpah04091]
 Calnexin / calreticulin
  110323460
SSDB
Motif
Pfam: Calreticulin ARGLU
Other DBs
NCBI-GeneID: 110323460
NCBI-ProteinID: XP_021056346
Ensembl: MGP_PahariEiJ_G0028614
LinkDB
Position
6:59991027..60050623
AA seq 417 aa
MCWVFFSLSPFSTDGWIKRWVQSKHQSDYGQFQLASGKFYQDKERDKGLQTTEDAKFYAL
SARFKPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPASLNQEDMHSESQYYIMFGPDIC
GFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLE
DDWDFLPPKKIKDPYARKPRKWDERQQIEDPEDKKPEDWEDSEFIPDPDAKKPDDWNEAM
DGVWEGPLIPNVKYQGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDSTIGHYHNISVLGLD
LWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWRELYEEMEKQKEAEETKKKR
EKERARQEDVWGLDEEDEEDAEEDDEEEAEERPKQEGSAERASLDQKGVHFDQKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtgttgggtttttttttctctctctcctttctccacagatggatggataaaacggtgg
gtacaatctaaacatcagtcagattacggccaattccagcttgcttcgggaaaattttat
caagataaagagagagataaaggtctccagaccacagaagatgccaagttctacgccctt
tccgccaggtttaagcccttcagcaatgagaatgagaccttggtggttcagttttcagta
aaacacgagcaaggtattgattgcggcggtggctacgtgaaactctttcctgcctcactg
aaccaggaggacatgcactcagaatcccagtattacatcatgttcggcccggacatctgt
ggctttggcaacaacagactacaggtcatcctttctcacaaagggaaataccatgagaac
aacaagaccctcaagtgcaggattaataaagacactcacctgtacactctgatccttcgc
cctaatgctacttatgaggttaaaattgacaaccagaaggtgacaagtggaggactggaa
gatgactgggacttcttgcctcccaagaaaataaaagacccctacgccaggaaaccaagg
aaatgggatgaacgacaacagatagaggatcctgaagataagaaacctgaggactgggag
gactctgaattcatcccagacccggatgccaagaagccagatgactggaatgaggcgatg
gatggagtgtgggaagggcccctgataccaaacgtcaagtaccagggagaatggaaacct
cggatcattgacaatcccaattaccagggggagtggattcacccagagatagacaacccc
aaatacaggcctgactctaccattggtcactatcacaatatcagtgtccttggtctggat
ctttggcaggtgaaatcaggcagcatttttgacaatttccttctaacaaatgatgaagag
tttgctgaagaggttggaaatatgacctggggattaagaaaggatgtggagcagcagtgg
agagagctgtatgaggaaatggagaaacagaaggaggcggaggagaccaagaagaagagg
gaaaaggagagagccaggcaagaggacgtctggggactagatgaggaggatgaggaggac
gctgaagaggatgacgaggaggaagcagaggaaagacccaagcaggaaggcagtgcagag
agggcatctctggaccaaaagggagtccactttgatcagaaggatgaactgtaa

KEGG   Mus pahari (shrew mouse): 110337259
Entry
110337259         CDS       T05929                                 
Symbol
Calr
Name
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04145  Phagosome
mpah04612  Antigen processing and presentation
mpah05142  Chagas disease
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110337259 (Calr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110337259 (Calr)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110337259 (Calr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110337259 (Calr)
   05170 Human immunodeficiency virus 1 infection
    110337259 (Calr)
   05168 Herpes simplex virus 1 infection
    110337259 (Calr)
   05163 Human cytomegalovirus infection
    110337259 (Calr)
   05169 Epstein-Barr virus infection
    110337259 (Calr)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110337259 (Calr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110337259 (Calr)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mpah04091]
    110337259 (Calr)
Chaperones and folding catalysts [BR:mpah03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   110337259 (Calr)
Lectins [BR:mpah04091]
 Calnexin / calreticulin
  110337259 (Calr)
SSDB
Motif
Pfam: Calreticulin MDM10 DDHD Astro_capsid_p
Other DBs
NCBI-GeneID: 110337259
NCBI-ProteinID: XP_021075721
Ensembl: MGP_PahariEiJ_G0022916
LinkDB
Position
20:complement(9320784..9325592)
AA seq 416 aa
MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctcctttcggtgccgctcctgcttggcctcctcggcctggccgccgcagaccctgcc
atctatttcaaagagcagttcttggacggagatgcctggaccaaccgctgggtcgaatcc
aaacataagtccgattttggcaaatttgtcctcagttctggcaaattttacggggaccag
gagaaggataaagggctgcagacaagccaagatgcccgattttacgcactgtctgccaaa
ttcgaacccttcagcaacaagggccagacactggtggtacagttcacggtgaagcatgag
cagaatatcgactgtgggggcggctacgtgaagctgtttccgagtggcttggaccagaag
gacatgcatggagactcagaatataacatcatgtttggtccagacatctgcggtcctggc
accaagaaggttcatgtcatctttaactacaagggcaagaatgtgctgatcaacaaggat
atccggtgcaaggatgatgaattcacacacctatacacactgattgtgcggccagacaac
acctatgaggtgaaaattgacaacagccaggtggagtcaggctccctggaggatgattgg
gactttctgccacccaagaagataaaggatcctgatgctgccaagccggaagactgggat
gaacgagccaagatcgatgaccccacagattccaagcctgaggactgggacaagccagag
cacatccctgaccctgatgctaagaagcctgaggactgggatgaagagatggatggagag
tgggaaccaccagtgattcaaaatcctgaatacaagggcgagtggaagccacgtcaaatt
gacaacccagattacaagggtacctggatacacccagaaattgacaaccctgaatactcc
cccgatgcaaatatctatgcctatgatagttttgctgtgctgggcctagatctctggcag
gtcaagtccggcacaatctttgacaacttcctcatcaccaatgatgaggcctatgcagag
gagtttggcaatgagacgtggggtgtcaccaaggctgcagagaagcagatgaaggacaag
caggatgaggagcagaggcttaaggaagaagaagaagacaagaagcgtaaagaggaagaa
gaagctgaggataaagaggatgaggatgacagagatgaagatgaagatgaagaagatgag
aaggaagaagatgaggaggatgccactggccaagccaaggatgagctgtag

DBGET integrated database retrieval system