KEGG   Mus pahari (shrew mouse): 110323472
Entry
110323472         CDS       T05929                                 

Gene name
Scube2
Definition
(RefSeq) signal peptide, CUB and EGF-like domain-containing protein 2 isoform X1
  KO
K24706  signal peptide, CUB and EGF-like domain-containing protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110323472 (Scube2)
SSDB
Motif
Pfam: FXa_inhibition Ephrin_rec_like cEGF EGF_CA EGF_3 CUB EGF hEGF PI3K_rbd
Other DBs
NCBI-GeneID: 110323472
NCBI-ProteinID: XP_021056374
Ensembl: MGP_PahariEiJ_G0013528
LinkDB
Position
1
AA seq 999 aa
MGVAGCGRPREAQALLLLLLLLLPPPLLTAAVPPDWGLTNGPSEAVDECAQGLDDCHADA
LCQNTPTSYKCSCKPGYQGEGRQCEDMDECDNALNGGCVHDCLNIPGNYRCTCFDGFMLA
HDGHNCLDMDECLENNGGCQHICTNVMGSYECGCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCGHICKEAPRGSVACECRPGFELAKNQKDCILTCNHGNGGCQHSCEDTAEGPECSCH
PRYRLHSDGRSCLEQEGTVLEGTESNATSVADGDKRVKRRLLMETCAVNNGGCDRTCKDT
STGVHCSCPTGFTLQVDGKTCKDIDECQTRNGGCNHFCKNAVGSFDCSCKKGFKLLTDEK
SCQDVDECSLERTCDHSCINHPGTFICACNRGYTLYSFTHCGDTNECSVNNGGCQQVCIN
TVGSYECQCHPGFKLHWNKKDCVEVKGFPPTSTTPRVSLHCGKSGGGDRCSLRCHSGIHL
WSDVVTVRTSVTFKLNEGKCSLQKAKLSPEGLRPALPERHSSVKESFQYANLTCSPGKQV
PGALGRPNTPKEMFITVEFERETYEKEVTASCNLSCVVKRTEKRLRKALRTLKRAAHREQ
FHLQLSGMDLNMAKTSPGVSGEQEETCGVGQSREESQCVSCRAGTYYDGSQERCILCPNG
TFQNEEGQVTCEPCPRPENLGSLKISEAWNVSDCGGLCQPGEYSANGFAPCQLCALGTFQ
PDVGRTSCLPCGGGLPTKHLGATSFQDCETRVQCSPGHFYNTTTHRCIRCPLGTYQPEFG
KNTCVSCPGNTTTDFDGSTNITQCKNRKCGGKLGDFTGYIESPNYPGNYPANSECTWTIN
PPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLW
IQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDV
LAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgggggtcgcgggttgcggtcggcctcgggaagcccaggcgctgttgctgctactgctg
ctgttgctgccgccgccgctgctgaccgccgccgtccctcccgactggggtctcaccaac
gggccgtctgaggctgtggatgagtgtgcccaagggctagatgactgccatgctgatgca
ctgtgtcagaacacacccacttcctacaagtgctcttgcaagcctggctaccaaggggaa
ggcaggcagtgtgaggacatggatgaatgtgacaatgcactcaatggaggctgtgtccac
gactgtttaaatattccaggcaactatcgctgcacctgtttcgatggcttcatgttggct
catgacggtcataattgtcttgatatggacgaatgcttggagaacaatggcggctgccag
cacatctgcaccaacgttatggggagctatgaatgtggctgcaaagaaggtttctttcta
agtgacaatcagcacacttgtatccaccgctcagaagaaggcctgagctgtatgaacaag
gatcatggctgtggtcacatctgcaaggaggccccgagaggcagtgttgcctgtgaatgc
aggcctggttttgaactggccaaaaaccagaaagactgcatcttgacttgtaaccatgga
aatggtgggtgtcagcactcctgtgaagatacagcagaaggccctgagtgtagttgccat
ccacggtataggttgcattctgatgggagaagctgcctagagcaagagggcactgtcttg
gaggggacagagagcaatgccacatcagtggcagatggagataaacgggtgaagaggcgg
ctgctcatggaaacgtgtgctgtcaacaatggaggctgcgaccgcacctgtaaggacacg
tcaacaggcgtccactgtagctgccccactggattcactctccaggtggatgggaagaca
tgtaaagatatcgatgagtgccagacccggaatggagggtgtaaccatttctgcaaaaac
gccgtgggcagttttgactgcagttgcaaaaaaggatttaaattactaacagacgagaag
tcttgccaagatgtggatgaatgttcgttggaaaggacctgtgaccacagctgcatcaac
caccctggcacttttatttgtgcctgcaacagaggatacacgctctatagcttcacccac
tgtggagacaccaacgagtgcagcgtcaacaatggaggctgccagcaagtttgcatcaac
acagtgggtagctacgagtgccagtgtcacccagggttcaagctccactggaataaaaaa
gactgtgtggaagtgaagggcttcccgcccactagcacgacaccgcgtgtgtccctgcac
tgtggtaaaagtggtggaggagacaggtgctccctcagatgccactctggcattcacctc
tggtcagatgtcgtcaccgtcaggacaagtgtaacctttaagctaaatgaaggcaagtgt
agtttgcaaaaggccaagctgtctcccgagggcctgcgaccagcactaccagagagacac
agctcagtaaaagagagcttccagtacgcaaaccttacatgcagccctggcaagcaagtc
ccgggagcccttggccgaccgaacacccctaaggaaatgtttatcacggttgagtttgaa
cgggaaacttacgaaaaggaggtgacagcttcctgcaatctgagctgcgtggtaaagcgc
acagagaagaggcttcggaaagctctccgcacactcaagagggctgcccacagggagcag
tttcatctgcagctctcaggcatggacctcaatatggctaaaacgtcccccggagtgtca
ggagagcaggaggagacctgtggagtgggccagagtcgtgaagaaagccagtgtgtcagt
tgcagggctgggacgtattatgatggatcacaagaacgctgcattttatgtccaaacgga
accttccaaaatgaggaaggacaagtcacttgtgaaccatgcccaagaccagaaaatctt
gggtctctaaaaatctcagaagcctggaatgtatctgactgtggaggcctttgtcagcca
ggtgaatattcagcaaatggatttgccccttgccagctctgtgccctgggcacctttcag
cctgacgtgggccgtacatcttgcctcccgtgcggaggaggtcttcccaccaaacatctg
ggagccacttccttccaggattgtgaaaccagagttcaatgctcgcctgggcatttctac
aacaccaccacacaccgatgtatccgatgcccactggggacataccagcctgaatttgga
aaaaatacttgtgtttcctgcccgggcaatactaccaccgactttgatggctccaccaac
ataacacagtgtaaaaacagaaagtgtggagggaagctgggggatttcacagggtatatt
gaatccccaaactaccctgggaactacccagccaactcagagtgcacctggaccatcaac
ccaccccccaaacgccggatcctgattgtggtccccgagatcttcctgcccatagaggat
gactgcggtgactacctggtgatgcggaaaacctcttcatcaaattctgtgaccacatat
gaaacctgccagacttatgaacgccccatcgccttcacctccaggtcaaagaaactgtgg
attcagttcaagtccaatgaagggaacagcgcccgggggttccaggttccctatgtgaca
tacgatgaagactaccaggagctcattgaagacattgttcgagatggcaggctctatgcc
tctgagaaccatcaggaaatactgaaggataagaaactgatcaaggctctgtttgatgtc
ctggcacatccccagaactatttcaagtacacagcccaggagtcccgagagatgtttcca
agatctttcatccgattgctacgttccaaagtgtcaaggtttctgaggccttacaaatga

DBGET integrated database retrieval system