KEGG   Mus pahari (shrew mouse): 110323473
Entry
110323473         CDS       T05929                                 
Symbol
Masp2
Name
(RefSeq) mannan-binding lectin serine protease 2 isoform X1
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323473 (Masp2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323473 (Masp2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110323473 (Masp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110323473 (Masp2)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     110323473 (Masp2)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110323473 (Masp2)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA cEGF EGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 110323473
NCBI-ProteinID: XP_021056370
Ensembl: MGP_PahariEiJ_G0029152
LinkDB
Position
6:99576079..99589168
AA seq 685 aa
MRLLIFLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYDDHQDRSWTLTAPPGYRLRLY
FTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGNDTFYSLGPSLKVTFHSD
YSNEKPFTGFEAFYAAEDVDECRVPLGDSVPCDHYCHNYLGGYYCSCRAGYVLHQNKHTC
SALCAGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQ
CPYDSLKIQTDKGEYGPFCGKTLPPRIETDSHKVTITFATDESGNHTGWKIHYTSTARPC
PDPMAPPNGSISPVQATYVLKDRFSVFCKTGFELLQGSVPLISFTAVCQKDGSWDRPMPE
CSIIDCGPPDDLPNGHVEYITGPLVTTYKAEIQYSCEETFYTMSSNGKYVCEADGFWTSS
KGEKFLPVCEPVCGLSTHTIGGRIVGGQPAKPGDFPWQVLLLDQTTAAAGALIHDNWVLT
AAHVVYGKRMTAPSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKN
KVTISGNIMPVCLPRKEAASLMRTDFTGTVAGWGLTQKGFLARNLMFVDIPIADHQKCTT
VYEKLYPEVRVTSNMLCAGLETGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCG
EADQYGVYTKVINYIPWIENIISNF
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgaggctcctcatcttcctgggtctgctgtggagtttggtggccacacttttgggttca
aagtggcctgagcctgtattcgggcgcctggtgtcccctggcttcccagagaagtatgac
gaccatcaggatcgatcgtggacactgactgcaccgcctggctaccgcctgcgcctctac
ttcacccacttcgacctggaactctcttaccgctgcgagtatgactttgtcaagttgagc
tcagggaccaaggtgctggccacactgtgtgggcaggagagtacagacactgagcaggca
cctggcaatgacaccttctactcactgggtcccagcctaaaggtcaccttccactccgac
tactccaatgagaagccgttcacaggatttgaggccttctatgcagcagaggatgtggat
gaatgcagagtgcccctgggagactcagtcccttgtgaccattattgccacaactacttg
ggcggctactattgctcctgcagagcgggctacgttctccaccagaacaagcacacgtgc
tcagccctttgtgcaggccaggtgttcacagggaggtctgggtatctcagtagccccgag
tacccgcagccataccccaagctctccagctgcacctacagcatccgcctggaggacggc
ttcagtgtcatcctggacttcgtggagtccttcgatgtggagacgcaccctgaagcccag
tgcccctacgactccctcaagattcaaacagacaagggggaatatggcccgttttgtggg
aagacactgcctcccaggattgaaactgacagccataaggtgaccatcacctttgccacc
gacgagtcagggaaccacacaggctggaagatacactacacaagcacagcacggccctgc
cctgatccaatggcgccacctaatggcagcatttcacctgtgcaagccacgtatgtcctg
aaggacaggttttctgtcttctgcaagactggcttcgagcttctgcaaggttctgtcccc
ctgatatcattcactgctgtctgtcagaaagatggatcttgggaccggccgatgccagag
tgcagcattattgattgtggccctcccgatgacctgcccaatggccatgtggaatacatc
acaggccctttagtgaccacctacaaagctgagattcagtacagctgtgaagagactttc
tacacaatgagcagcaatggtaaatatgtgtgtgaggctgatggattctggacgagctcc
aaaggagaaaaattcctcccggtttgtgagcctgtttgtgggctgtccacacacactata
ggaggacgcatagttggagggcagcctgcaaagcctggtgactttccttggcaagtcttg
ttactggatcaaactacagcagcagcaggtgcacttatacatgacaattgggtcctaaca
gccgcccatgttgtatatgggaaaagaatgacagcaccttccctggacatccgaatgggt
atcctcaaaaggctctcacctcattatactcaagcctggccggaggcagtctttatacac
gaaggctacactcacggtgctggttttgacaatgatatagcattgattaaactcaagaac
aaagtcacaatcagtggaaacatcatgcctgtttgcctacctagaaaagaagctgcatcc
ttaatgagaacagacttcactggaactgtggctggctgggggttaacccagaaggggttt
ctggctagaaacctaatgtttgttgacataccaattgctgaccaccaaaaatgtactact
gtgtatgaaaagctctacccagaagtaagagtaacttctaacatgctctgtgctggctta
gaaactggtggcaaggacagctgcagaggcgacagtggaggggcgttagtgtttctagat
aatgaaacacagcgatggtttgtaggaggaatagtttcctggggttccattaattgtggg
gaggcagaccagtatggggtctacacaaaagtcatcaactatattccctggattgagaac
ataataagtaatttctaa

KEGG   Mus pahari (shrew mouse): 110329505
Entry
110329505         CDS       T05929                                 
Symbol
Masp1
Name
(RefSeq) mannan-binding lectin serine protease 1
  KO
K03992  mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110329505 (Masp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110329505 (Masp1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110329505 (Masp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110329505 (Masp1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     110329505 (Masp1)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110329505 (Masp1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA Trypsin_2 CUB_2 cEGF Peptidase_S6 DUF1986
Other DBs
NCBI-GeneID: 110329505
NCBI-ProteinID: XP_021064789
Ensembl: MGP_PahariEiJ_G0016323
LinkDB
Position
12:complement(18778156..18850449)
AA seq 704 aa
MRFLSFWRLLLYHALCLALPEVSAHTVELNEMFGQIQSPGYPDSYPSDSEVTWNITVPEG
FRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGTFMS
VTFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILH
TDNRTCRVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVSLQFEDIFDIE
DHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQTHSVQILFRSDNSGENRGWRLSYR
AAGNECPKLQPPMYGKIEPSQAVYSFKDQVLISCDTGYKVLKDNEVMDTFQIECLKDGAW
SNKIPTCKIVDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCS
AHGTWTNEVLKRSLPTCLPVCGLPKFSRKQISRIFNGRPAQKGTTPWIAMLSHLNGQPFC
GGSLLGSNWVLTAAHCLHHPLDPEEPTLHDSYLLSPSDFKIILGKHWRRRSDEDEQHLRV
KHTMLHPLYDPSTFENDLGLVELSESPRLNDFVMPVCLPEQPSAEGTMVIVSGWGKQFLH
RFPENLMEIEIPVVDYDTCQEAYTPLKKKVTKDMICAGEKEGGKDACAGDSGGPMVTKDA
ERDQWYLVGVVSWGEDCGKKDRYGVYSYIYPNKDWIQRITGVRN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgaggttcctgtctttctggcggctcctcctctaccacgctctgtgcctcgccctgccg
gaggtctcagcccatactgtggagctaaatgaaatgtttggtcaaatccagtcacctggc
tatccagattcctatccaagtgactctgaggtgacatggaatattactgtcccagagggc
tttcggatcaagctttacttcatgcacttcaacttggaatcctcctatctttgtgaatac
gactatgtgaaggtagaaacagaagaccaggtgctggcaaccttctgtggcagggagacc
accgataccgagcagacccccggccaggaagtggttctttcgcctggcaccttcatgtct
gtcactttccggtcagatttctccaatgaggaacgattcacaggcttcgacgcccactac
atggctgtagatgtggatgagtgcaaggagagggaagacgaagagctgtcctgtgaccac
tactgtcacaactacatcggtggctactactgctcctgccgctttggctacatcctccac
acagacaacaggacctgccgagtggaatgcagcggcaatctctttacccagaggacaggc
acaatcaccagccccgattaccccaacccttaccccaagagctcagaatgttcctatacc
attgacctggaggagggctttatggtcagcctgcagtttgaggacatttttgacattgaa
gaccatcctgaggtgccctgtccctatgactacattaagattaaagctggttcaaaagta
tggggtcccttctgtggagagaaatccccagaaccaatcagcacccagactcacagtgtc
cagatcctattccgcagcgacaactcaggagagaaccgaggctggaggctctcctacaga
gcagcaggaaatgagtgcccaaagctacagcctcctatgtatgggaaaatcgagccctcg
caggccgtgtattccttcaaagaccaagtgctcatcagctgtgacaccggctacaaagtg
ctaaaggataatgaggtgatggacacattccaaattgaatgtctgaaggatggtgcatgg
agtaacaagatccccacctgtaaaattgtagactgtggagctccagcagggctgaaacat
gggctagtaaccttctccaccagaaacaacctcaccacatacaaatctgagataaggtac
tcctgccagcagccctactacaagatgcttcacaataccacaggtgtatatacgtgttct
gctcatgggacctggacgaatgaggtgctgaagagaagcctgcccacctgccttccagtg
tgtggtctccccaagttctcccggaagcagatctccaggatcttcaatggccgcccagcc
cagaagggtactactccatggattgccatgctgtcacacctgaatggacaacccttctgt
gggggtagtcttttaggctccaactgggttttgacggctgctcactgcctccaccatcca
cttgatccagaagaaccaaccctacacgactcatacttgctcagcccttctgacttcaaa
attatcttgggaaagcactggagacgccgctcagacgaggacgagcagcatctgcgtgta
aagcacaccatgctccacccactgtacgaccccagcacgtttgaaaatgaccttggtctg
gtggaactgtcagagagcccgaggctgaacgactttgtgatgcctgtctgtctgcctgag
cagccttccgctgaaggaaccatggtcatcgtcagcggctgggggaagcagttcttgcac
aggtttccagagaacctgatggagattgaaatcccagttgtagactacgacacctgccag
gaggcctataccccattgaagaagaaagtgaccaaggacatgatctgtgccggagaaaag
gaaggggggaaagatgcctgtgctggtgactctggaggccctatggtgaccaaagatgca
gagagagaccaatggtacctggtgggcgtggtgtcctggggtgaagattgcgggaagaaa
gatcgctatggagtttattcttacatctaccccaacaaggactggatccagaggatcact
ggggtgaggaactga

DBGET integrated database retrieval system