KEGG   Mus pahari (shrew mouse): 110323604
Entry
110323604         CDS       T05929                                 
Symbol
C1qb
Name
(RefSeq) complement C1q subcomponent subunit B
  KO
K03987  complement C1q subcomponent subunit B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05020  Prion disease
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323604 (C1qb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323604 (C1qb)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110323604 (C1qb)
   05150 Staphylococcus aureus infection
    110323604 (C1qb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110323604 (C1qb)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110323604 (C1qb)
  09164 Neurodegenerative disease
   05020 Prion disease
    110323604 (C1qb)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110323604 (C1qb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323604 (C1qb)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110323604 (C1qb)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 110323604
NCBI-ProteinID: XP_021056579
Ensembl: MGP_PahariEiJ_G0029001
LinkDB
Position
6:complement(87828355..87834026)
AA seq 253 aa
MKKQWGEIWTPLLLLLLGLLHVSQAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEK
GLPGLAGDHGEFGEKGDPGIPGTPGKVGPKGPVGPKGAPGPSGPRGPKGDSGDYKATQKV
AFSALRTINSPLRPNQVIRFEKVITNMNEDYEPRSGKFTCKVPGLYYFTYHASSRGNLCV
NLVRGRDRGSMQKVLTFCDYSYNTFQVTTGGVVLKLEQQEVVHLQATDKNSLLGIEGANS
IFTGFLLFPDADA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagaaacagtggggtgagatctggacacccctgttattgctgctcctgggtttgctc
catgtctcccaggcccaaagcagctgcaccgggccccctggcatccctggcatccctggg
gtccctggggtccctggctctgatggccaaccaggcactccagggattaagggggagaaa
gggctccccggactggctggagaccatggtgagtttggagagaaaggggacccagggatc
cctgggactccaggcaaagttggccctaagggtcccgtcggccctaagggtgctccgggc
ccctctggaccccgtggtcccaaaggcgactctggggactacaaggctacacagaaagtc
gccttctctgccctgaggaccatcaacagccccctgcgaccgaaccaggtcattcgcttc
gaaaaggtgatcaccaacatgaacgaggactacgagccccgcagcggcaagttcacctgc
aaggtgcctggcctctactacttcacctaccacgccagctcccggggcaacctgtgtgtg
aacctcgtgcgtggccgcgatcggggcagcatgcagaaagtactcaccttctgtgactac
tcctataacaccttccaggtcaccaccggtggggtagtcttgaagctagagcaacaggag
gttgttcacctgcaggccacagacaagaactccctcctgggcattgagggcgccaacagc
atcttcactggcttcctgcttttccctgacgcggatgcctaa

KEGG   Mus pahari (shrew mouse): 110323611
Entry
110323611         CDS       T05929                                 
Symbol
C1qc
Name
(RefSeq) complement C1q subcomponent subunit C
  KO
K03988  complement C1q subcomponent subunit C
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05020  Prion disease
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323611 (C1qc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323611 (C1qc)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110323611 (C1qc)
   05150 Staphylococcus aureus infection
    110323611 (C1qc)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110323611 (C1qc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110323611 (C1qc)
  09164 Neurodegenerative disease
   05020 Prion disease
    110323611 (C1qc)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110323611 (C1qc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323611 (C1qc)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110323611 (C1qc)
SSDB
Motif
Pfam: C1q Collagen BclA_C OapA
Other DBs
NCBI-GeneID: 110323611
NCBI-ProteinID: XP_021056590
Ensembl: MGP_PahariEiJ_G0029002
LinkDB
Position
6:complement(87837507..87840639)
AA seq 247 aa
MVLGPSCQPQCGLCLLPLLLLLALPLRSQAGAGCYGIPGMPGMPGAPGKDGHDGLQGPKG
EPGIPAVPGTRGPKGQKGEPGMPGHRGKNGPMGTSGLPGDPGPRGPPGEQGEEGRYKQKH
QSVFTVTRQTAQYPTANALVRFNSVVTNPQGHYDTSTGKFTCEVPGLYYFVYHTSQTANL
CVHLNLNLARVTSFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSDSVFS
GFLLFPD
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtcctcggacccagttgccagcctcaatgtggactttgcctgctgccgctgctgctg
cttctggccctaccactcaggagccaggccggcgctggctgctatgggatcccagggatg
ccaggcatgccgggggcccctgggaaggacgggcatgatggactccaggggcccaagggt
gagccaggaatcccagccgtccctggaacccgaggacccaagggtcagaagggcgagcct
ggcatgcctggccaccgtgggaaaaatggccccatggggacctcagggttgccaggggac
ccaggccccagggggcctcccggggagcagggtgaggagggtcgatacaaacagaagcat
cagtcggtattcacggtcacccggcagaccgcccagtacccaacggccaacgctctcgtc
aggttcaactcggtggtcaccaaccctcaggggcattatgacacaagcacagggaagttc
acctgcgaagtgccgggcctctattacttcgtctaccacacatcgcagacggccaacctg
tgcgtacacctgaatctcaaccttgccagggtgaccagcttctgcgaccacatgttcaac
agcaagcaggtcagctccggaggagtcctcctgcggcttcagaggggcgatgaggtgtgg
ctgtcggtcaacgactacaatggcatggtgggcatagagggctccgacagcgtcttctct
ggtttcctactgtttcccgactag

KEGG   Mus pahari (shrew mouse): 110323698
Entry
110323698         CDS       T05929                                 
Symbol
C1qa
Name
(RefSeq) complement C1q subcomponent subunit A
  KO
K03986  complement C1q subcomponent subunit A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04936  Alcoholic liver disease
mpah05020  Prion disease
mpah05133  Pertussis
mpah05142  Chagas disease
mpah05150  Staphylococcus aureus infection
mpah05171  Coronavirus disease - COVID-19
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110323698 (C1qa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110323698 (C1qa)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110323698 (C1qa)
   05150 Staphylococcus aureus infection
    110323698 (C1qa)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110323698 (C1qa)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110323698 (C1qa)
  09164 Neurodegenerative disease
   05020 Prion disease
    110323698 (C1qa)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110323698 (C1qa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323698 (C1qa)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110323698 (C1qa)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 110323698
NCBI-ProteinID: XP_021056708
Ensembl: MGP_PahariEiJ_G0029003
LinkDB
Position
6:complement(87843758..87846486)
AA seq 245 aa
METSQGWLVACVLAMTLAWTVAEDVCRAPNGKDGAPGNPGRPGRQGLKGERGEPGAAGIR
TGIRGLKGDPGEPGPPGKPGNVGFPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAI
RQNPGTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFTFQVISKWDLCLSIKSSSR
GQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPEKGRIYQGTEADSIFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagacctctcagggttggctggtggcctgtgtgctggccatgaccctagcatggaca
gtggctgaagatgtctgccgagcacccaacgggaaggatggggctccaggaaatcctggc
cgcccggggaggcagggtctcaaaggagagagaggggagccaggagctgctggcatccgg
accggtatccgaggtttaaaaggagacccaggggaacctggtccccctggcaaacctggc
aatgtggggttcccgggtcccagtggtcccctgggggacagcggcccccaaggactgaag
ggcgtgaaaggcaatccaggcaatatcagggaccagccccggccagctttctcagctatt
cggcagaacccagggacgcttggcaacgtggttatctttgacaaggtcctcaccaaccaa
gagagtccataccagaaccacacgggtcgcttcatctgtgcagtgcccggcttctattac
ttcaccttccaagtgatctccaagtgggacctctgtctgtctatcaagtcttcctccagg
ggccagcccaggaattccctgggtttctgtgacaccaacagcaaggggctcttccaggtg
ttagcagggggtaccgtgcttcagttgcaacgaggggacgaggtgtggatcgagaaggac
cccgaaaagggtcgcatttaccagggcactgaagccgacagcatcttcagtggattcctc
attttcccctcagcctga

DBGET integrated database retrieval system