KEGG   Mus pahari (shrew mouse): 110323788
Entry
110323788         CDS       T05929                                 
Symbol
Tyrp1
Name
(RefSeq) 5,6-dihydroxyindole-2-carboxylic acid oxidase
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00350  Tyrosine metabolism
mpah01100  Metabolic pathways
mpah04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110323788 (Tyrp1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110323788 (Tyrp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110323788 (Tyrp1)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-
     110323788 (Tyrp1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   110323788 (Tyrp1)
SSDB
Motif
Pfam: Tyrosinase Laminin_EGF
Other DBs
NCBI-GeneID: 110323788
NCBI-ProteinID: XP_021056811
Ensembl: MGP_PahariEiJ_G0028453
LinkDB
Position
6:33074745..33100884
AA seq 537 aa
MKSYKVLTLASTFLPLVLFHQIWAQFPRECANVEALRRGVCCPDLLPSSGPGTDPCGSSS
GRGRCVTVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGA
ACNQKILTVRRNLLDLNQEEKSHFVRALDMAKRTTHPQFVIATRRSEDILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGAGQESFGDVDFSHEGPAFLTWHRYHLLQLERDMQDMLQ
EPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPNSVFSQWRVVCESLEEYDTLG
TLCNSTEGGPIRRNPAGNVGRPAVQRLPAPQDVTQCLEVRVFDTPPFYSNSTDSFRNTVE
GYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQEFTVSEIIT
IAVVAALLLVAAIFGGASCLIRSRSAKNEANQPLLTDHYQRYAEEYEELPNPNQSMV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaaatcttacaaagtcctcaccctagcctccaccttccttcccctggtgctgtttcat
cagatctgggctcagtttccacgagagtgtgccaatgttgaggctctgagacgtggggta
tgttgcccagacctgctcccttcctctggtccagggactgacccttgtggctcatcatca
ggaagaggcaggtgtgtgaccgtgattgcagactcccgaccccacagccgccattatccc
catgatggtaaagacgaccgagaagcctggcctctgaggttctttaatagaacatgtcag
tgcaatgataatttctcaggacacaactgtgggacttgccgtcctgggtggagaggagct
gcatgcaaccagaaaattctcacagtcaggagaaatcttctggacttaaatcaagaagaa
aagagccactttgtcagggccttggatatggcgaagcgtacaactcaccctcaatttgtc
attgccacaaggaggtcagaagacatactgggaccagatggcaacacaccacaatttgag
aacatttccatttacaactactttgtttggacacactattattcagtcaaaaaaaccttc
cttggggcaggacaggaaagctttggcgatgtggatttctctcacgaaggaccagctttt
ctcacatggcacagataccatctgctgcagctggagagagacatgcaggacatgctgcag
gagccttcattctcccttccctactggaattttgcaactgggaaaaacgtctgcgatgtc
tgcaccgacgatttgatgggatccagaagcaacttcgattctactcttataagccccaac
tctgtcttttctcagtggagagtggtctgtgaatccttagaagagtacgataccctggga
acactttgtaacagcactgagggtggacccatcaggagaaacccagctggaaatgtaggc
agaccagcagtgcagcgccttccagcaccacaggatgtcactcagtgcttggaggtccgt
gtatttgacacacctcctttctattccaattctacagacagttttcgaaatacagtggaa
ggttacagtgctcccacgggaaaatatgaccctgctgttcgaagccttcacaacctggcc
cacctcttcctgaatggaacaggaggacaaacccatttgtctcccaatgatcctattttt
gtcctcctgcatacgttcactgatgcagtctttgacgaatggctaaggaggtacaatgcc
gatatttctaccttcccattggaaaacgctcctattggacataacaggcaatacaacatg
gttccattctggccaccagttaccaacacagaaatgtttgttactgctccagacaacctg
ggatatgcttatgaagttcaatggccaggtcaggagttcactgtatctgaaatcattacc
attgctgtagtggctgcgctgttacttgtagctgccattttcgggggcgcttcttgtctg
atccgttcgagaagcgccaagaatgaagccaatcagcctctcctcactgatcactatcaa
cgctatgctgaggagtatgaggaactcccgaatcctaaccaatccatggtctga

DBGET integrated database retrieval system