Mus pahari (shrew mouse): 110324365 Help Entry 110324365         CDS       T05929                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos isoform X1   KO K04379   proto-oncogene protein c-fos Organism mpah  Mus pahari (shrew mouse) Pathway mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04024   cAMP signaling pathway mpah04210   Apoptosis mpah04380   Osteoclast differentiation mpah04620   Toll-like receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04668   TNF signaling pathway mpah04713   Circadian entrainment mpah04725   Cholinergic synapse mpah04728   Dopaminergic synapse mpah04915   Estrogen signaling pathway mpah04917   Prolactin signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04928   Parathyroid hormone synthesis, secretion and action mpah04932   Non-alcoholic fatty liver disease mpah04935   Growth hormone synthesis, secretion and action mpah05031   Amphetamine addiction mpah05132   Salmonella infection mpah05133   Pertussis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05161   Hepatitis B mpah05162   Measles mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05207   Chemical carcinogenesis - receptor activation mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05210   Colorectal cancer mpah05224   Breast cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110324365 (Fos)    04668 TNF signaling pathway     110324365 (Fos)    04024 cAMP signaling pathway     110324365 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110324365 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110324365 (Fos)    04660 T cell receptor signaling pathway     110324365 (Fos)    04658 Th1 and Th2 cell differentiation     110324365 (Fos)    04659 Th17 cell differentiation     110324365 (Fos)    04657 IL-17 signaling pathway     110324365 (Fos)    04662 B cell receptor signaling pathway     110324365 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     110324365 (Fos)    04917 Prolactin signaling pathway     110324365 (Fos)    04921 Oxytocin signaling pathway     110324365 (Fos)    04926 Relaxin signaling pathway     110324365 (Fos)    04935 Growth hormone synthesis, secretion and action     110324365 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     110324365 (Fos)   09156 Nervous system    04725 Cholinergic synapse     110324365 (Fos)    04728 Dopaminergic synapse     110324365 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     110324365 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     110324365 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110324365 (Fos)    05207 Chemical carcinogenesis - receptor activation     110324365 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     110324365 (Fos)    05231 Choline metabolism in cancer     110324365 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110324365 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     110324365 (Fos)    05224 Breast cancer     110324365 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110324365 (Fos)    05170 Human immunodeficiency virus 1 infection     110324365 (Fos)    05161 Hepatitis B     110324365 (Fos)    05171 Coronavirus disease - COVID-19     110324365 (Fos)    05162 Measles     110324365 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     110324365 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     110324365 (Fos)    05135 Yersinia infection     110324365 (Fos)    05133 Pertussis     110324365 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     110324365 (Fos)    05142 Chagas disease     110324365 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     110324365 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     110324365 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110324365 (Fos)    05418 Fluid shear stress and atherosclerosis     110324365 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110324365 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110324365 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpah03000]     110324365 (Fos)    04131 Membrane trafficking [BR:mpah04131]     110324365 (Fos) Transcription factors [BR:mpah03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     110324365 (Fos) Membrane trafficking [BR:mpah04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     110324365 (Fos) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ Motif Other DBs NCBI-GeneID:  110324365 NCBI-ProteinID:  XP_021057530 Ensembl:  MGP_PahariEiJ_G0029726 LinkDB All DBs Position 7:80629648..80632989 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASARPSGSETSRSVPDVDLSGSFYA ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg ggctcgcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcagggggcagagcg cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag ctgacagatacgctccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag actgagattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac cgacctgcctgcaagatccccgatgacctaggcttcccagaggagatgtctgtggcctcc ctggatttgactgggggtctgcctgaggctgccaccccagagtctgaggaggccttcacc ctgccccttctcaacgaccctgaacccaagccatccttggagccagtcaagagcatcagc aacgtggagttgaaggctgaaccctttgatgacttcttgtttccggcatctgctaggccc agtggctcggagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca gcagactgggaacctctgcacagcagttccctggggatggggcccatggtcacagagctg gaacccctgtgtactcccgtggtcacctgtactcccggctgcactacgtatacgtcttcc tttgtcttcacctatccagaggctgactccttcccaagctgtgcagctgcccaccgaaag ggcagcagcagcaacgagccctcctccgactcactgagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system