KEGG   Mus pahari (shrew mouse): 110324417
Entry
110324417         CDS       T05929                                 
Symbol
Itgb8
Name
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04514  Cell adhesion molecules
mpah04810  Regulation of actin cytoskeleton
mpah05165  Human papillomavirus infection
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110324417 (Itgb8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110324417 (Itgb8)
   04514 Cell adhesion molecules
    110324417 (Itgb8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324417 (Itgb8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324417 (Itgb8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110324417 (Itgb8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110324417 (Itgb8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110324417 (Itgb8)
   05414 Dilated cardiomyopathy
    110324417 (Itgb8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110324417 (Itgb8)
   04515 Cell adhesion molecules [BR:mpah04515]
    110324417 (Itgb8)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110324417 (Itgb8)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin beta subunits
   110324417 (Itgb8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 110324417
NCBI-ProteinID: XP_021057635
Ensembl: MGP_PahariEiJ_G0029948
LinkDB
Position
7:complement(112633315..112711825)
AA seq 767 aa
MCGSALAFLTAALLSLHNCQRGPALVLGAAWVFSLVLGLGQSEHSRCGSASAVSCARCLQ
LGPECGWCVQEDFVSSGSRSERCDTVSNLISKGCPVDSIEYLSVHVITSSENEINTQVTP
GEVSIQLHPGAEANFMLKVRPLKKYPVDLYYLVDVSASMHNNIEKLNSIGNDLSKKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYIKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
AIAGEIESKAANLNNLVVEAYKKLISEVKMQLENQVHGVHFNITAICPDGARKPGISGCG
NVTSNDEVLFNVTVVMKTCDIIGGKNYAIIKPIGFNETTKVHIHSSCSCQCEDHRGLKGQ
CAEAAPDPKCPQCDESKCHFDEDQFPSEMCKPQEDQPVCSGRGVCVCGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCAGHGECEGGRCQCFSGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRLCEHCPTCHLSCSENWNCLQCLHPHNLSQAVLDQCKTSC
AVMEQHHMDQTSECLSGPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDY
RMSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAQEAFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgcggctcggccctggcttttctgactgctgcactgctctccctgcacaactgccag
cgaggtccagccttggttcttggggcagcgtgggtattttcacttgttctcggactgggc
caaagtgaacacagtagatgtggctctgcaagtgcggtctcctgtgccaggtgcctccag
ctgggtccggaatgcggatggtgtgttcaagaggattttgtttcaagtggatcaagaagt
gaacgttgtgatactgtttccaatttgataagcaaaggctgtccagttgattcaatagaa
tacctgtctgtgcatgtaataacatcaagtgagaatgaaatcaatacccaagtgacaccg
ggagaagtctcaatccaactgcatccaggagctgaagctaattttatgttaaaagtccgt
cctctgaagaaataccccgtggatctttattatctggttgatgtgtcagcgtcaatgcac
aataatatagaaaaattgaattccattggaaacgatttatctaaaaaaatggcctttttt
tcccgtgacttccgtcttggttttggctcatatgtggataaaactgtctcaccatatatt
agtattcacccggaaaggatccacaatcagtgcagtgactacaacttagactgtatgcct
ccccatggatacattcatgtgctgtctctgacagaaaacatcactgagtttgaaaaagca
gtccacagacaaaagatctctggaaacatagacacccctgaaggaggttttgatgccatg
cttcaggctgccgtttgtgagagtcatattggatggcgaaaagaagctaaaagattgctg
ctggtgatgacagaccagacatcacatcttgctcttgacagcaaattggcaggcatagtg
gtgccgaatgacggaaactgccatctgaaaaacaacgtctacatcaaatcgacaaccatg
gaacatccgtcattaggccaactttctgaaaagttaatagacaacaacataaatgtcatt
tttgcagttcaaggaaagcagtttcattggtacaaggaccttctgccccttttgcctggt
gccattgctggtgaaatagaatccaaagctgcaaatctcaataatttagtagtagaagcc
tacaagaagctcatctcagaagtaaaaatgcagctggaaaaccaggtacacggtgtccat
tttaacatcactgccatctgtccagatggggccagaaagccaggcataagtgggtgtgga
aacgtgacaagcaatgacgaagttcttttcaatgtaactgttgtgatgaaaacatgtgat
atcataggaggaaaaaactatgcaattatcaaacctattggtttcaatgaaacaactaaa
gtccacatacacagcagctgcagttgccagtgtgaggaccacagaggactcaaaggacag
tgtgcagaagctgccccagatcccaagtgtccacagtgtgatgagagcaaatgtcatttt
gatgaagaccagtttccttctgaaatgtgcaagccacaggaggatcaacctgtttgcagt
ggccgaggtgtttgcgtctgtgggaaatgtttatgtcacaaaaccaagctgggcagagtg
tatggacagtactgtgagaaggatgacttctcctgtccctatctccatggggatgtgtgt
gctgggcacggagagtgcgaaggtggcagatgccagtgctttagtggctgggaaggggat
cggtgtcagtgtccgtcagcctcagcacagcactgtgtcaactccaagggccaagtttgc
agcgggagaggcacctgcgtgtgtggcaggtgtgagtgtactgatcccagaagcattggc
cgtctctgtgagcactgcccaacctgccatctatcctgcagtgaaaactggaattgtctg
cagtgccttcaccctcacaatctgtctcaagctgtccttgatcagtgtaaaacctcctgt
gctgtcatggaacagcatcacatggaccaaacatcagaatgtttatctggcccaagctat
ctgcgaatatttttcatcatattcatagtcacattcttgatcgggttgctcaaagttctt
attattagacaggtgatactacaatggaatagtaataaaataaagtcctcatcagattac
agaatgtctgcttccaaaaaggataaactgattctgcaaagtgtttgcacgagggctgtg
acctaccgacgagaaaagcctgaggaaataaaaatggatatcagcaaactaaatgctcag
gaggccttcaggtgcaacttctaa

DBGET integrated database retrieval system