KEGG   Mus pahari (shrew mouse): 110324428
Entry
110324428         CDS       T05929                                 
Name
(RefSeq) alpha-1-antitrypsin 1-3 isoform X1
  KO
K03984  alpha-1-antitrypsin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110324428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110324428
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110324428
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110324428
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110324428
SSDB
Motif
Pfam: Serpin Cyt_c_ox_IV
Other DBs
NCBI-GeneID: 110324428
NCBI-ProteinID: XP_021057651
Ensembl: MGP_PahariEiJ_G0029823 MGP_PahariEiJ_G0029824
LinkDB
Position
7:complement(97955115..97965025)
AA seq 435 aa
MYCAIHVQLSRLYSQRQEARWKMTPSISWGLVLLAGLCCLVPSFLAESVQETDTSQKDQS
PASHEIATNLGDFAFSLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGL
RFNLTQVSEADIHKAFQHLLQTLNKPNSELQLSSGNGLFVDNKLKLGEKFVEEAKTHYHS
EAFSVNFAESEEAMKAINDFVEKGTQGKIVDAVKDLDKDTVFALANYIFFKGKWKKPFDP
EHTADADFHVDESTTVKVPMMTLTSMFDVHYCTTLSSWVVLMDYLGNATAVFLLPDDGKM
QHLEQTLNKELISKFLLSRRTRLAEIHFPKLSISGSYDLKTLMSPLGITRVFNNGADLSR
ITEENAPLKLSKAVHKAVLTIDEQGTEAAGTTVLGAVPMSMPPTVNFNHPFIFIIFETHS
QSPLFVGKVVDPTRK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtactgtgccatccatgttcagctctccagattatacagtcaaaggcaggaagcacga
tggaaaatgactccctccatctcatggggtctagtgcttctggcaggcctgtgttgcctg
gtccccagctttctggctgagagtgtccaggagacagacacttcccagaaggatcagtcc
ccagcctctcatgagatcgctacaaacctgggagacttcgccttcagcctatacagggag
ctggtccatcagtccaacacttccaacatcttcttctccccagtgagcattgccacagcc
tttgctatgctctccctagggagcaagggtgacactcacacgcagattctagagggcctg
cgcttcaacctcacacaagtatcagaggctgacatccacaaggccttccaacacctcctc
caaaccctcaacaagccaaacagtgagctgcagctgagctcgggcaatggcctctttgtc
gacaataaactgaagctgggagagaagtttgtggaagaggccaagacccattaccactca
gaagccttctccgtcaactttgcagagtcagaggaggccatgaaagcgattaatgatttt
gtggagaagggaacccaggggaagatagttgatgcggtgaaagacctggacaaagacaca
gttttcgccctggcgaattacattttctttaaaggcaagtggaagaagccattcgatccc
gagcacactgcagacgctgacttccacgtggacgagtccaccacggtgaaggtgcccatg
atgaccctcacgagcatgtttgacgtgcactattgcaccacgctgtccagctgggtggtg
ctgatggattacctgggcaacgccactgctgtcttcctcctgcccgatgatggcaagatg
cagcatctggagcaaactctcaacaaggagctcatctctaagttcctgctaagcaggcgc
acaaggttagccgagatccacttccccaaactgtccatctctggaagctatgacttgaag
acgctcatgagtccactgggcatcacccgggtcttcaacaatggggctgacctctccaga
atcacagaggagaatgctcccctgaagctcagcaaggctgtgcataaggctgtgctgacc
attgatgagcaaggaacagaagctgcaggaaccacagtacttggagccgttcccatgtct
atgccccctaccgtgaacttcaaccaccctttcattttcataatatttgaaacacacagt
cagagccccctctttgtgggaaaagtggtggatcccacacgtaaatga

KEGG   Mus pahari (shrew mouse): 110324489
Entry
110324489         CDS       T05929                                 
Name
(RefSeq) alpha-1-antitrypsin 1-3-like
  KO
K03984  alpha-1-antitrypsin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110324489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110324489
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110324489
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110324489
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110324489
SSDB
Motif
Pfam: Serpin Cyt_c_ox_IV
Other DBs
NCBI-GeneID: 110324489
NCBI-ProteinID: XP_021057765
Ensembl: MGP_PahariEiJ_G0029820
LinkDB
Position
7:complement(97945335..97949760)
AA seq 435 aa
MYCAIHVQLSRLYSQRQEARWKMTPSISWGLVLLAGLCCLVPSFLAESVQETDTSQKDQS
PASHEIATNLGDFAFSLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGL
RFNLTQVSEADIHKAFQHLLQTLNKPNSELQLSSGNGLFVDNKLKLGEKFVEEAKTHYHS
EAFSVNFAESEEAMKAINDFVEKGTQGKIVDAVKDLDKDTVFALANYIFFKGKWKKPFDP
EHTADADFHVDESTTVKVPMMTLTSMFDVHYCTTLSSWVVLMDYLGNATAVFLLPDDGKM
QHLEQTLNKELISKFLLSRRTRLAEIHFPKLSISGSYDLKTLMSPLGITRVFNNGADLSR
ITEENAPLKLSKAVHKAVLTIDEQGTEAAGTTVLGAVPMSMPPTVNFNHPFIFIIFETHS
QSPLFVGKVVDPTRK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtactgtgccatccatgttcagctctccagattatacagtcaaaggcaggaagcacga
tggaaaatgactccctccatctcatggggtctagtgcttctggcaggcctgtgttgcctg
gtccccagctttctggctgagagtgtccaggagacagacacttcccagaaggatcagtcc
ccagcctctcatgagatcgctacaaacctgggagacttcgccttcagcctatacagggag
ctggtccatcagtccaacacttccaacatcttcttctccccagtgagcattgccacagcc
tttgctatgctctccctagggagcaagggtgacactcacacgcagattctagagggcctg
cgcttcaacctcacacaagtatcagaggctgacatccacaaggccttccaacacctcctc
caaaccctcaacaagccaaacagtgagctgcagctgagctcgggcaatggcctctttgtc
gacaataaactgaagctgggagagaagtttgtggaagaggccaagacccattaccactca
gaagccttctccgtcaactttgcagagtcagaggaggccatgaaagcgattaatgatttt
gtggagaagggaacccaggggaagatagttgatgcggtgaaagacctggacaaagacaca
gttttcgccctggcgaattacattttctttaaaggcaagtggaagaagccattcgatccc
gagcacactgcagacgctgacttccacgtggacgagtccaccacggtgaaggtgcccatg
atgaccctcacgagcatgtttgacgtgcactattgcaccacgctgtccagctgggtggtg
ctgatggattacctgggcaacgccactgctgtcttcctcctgcccgatgatggcaagatg
cagcatctggagcaaactctcaacaaggagctcatctctaagttcctgctaagcaggcgc
acaaggttagccgagatccacttccccaaactgtccatctctggaagctatgacttgaag
acgctcatgagtccactgggcatcacccgggtcttcaacaatggggctgacctctccaga
atcacagaggagaatgctcccctgaagctcagcaaggctgtgcataaggctgtgctgacc
attgatgagcaaggaacagaagctgcaggaaccacagtacttggagccgttcccatgtct
atgccccctaccgtgaacttcaaccaccctttcattttcataatatttgaaacacacagt
cagagccccctctttgtgggaaaagtggtggatcccacacgtaaatga

KEGG   Mus pahari (shrew mouse): 110324788
Entry
110324788         CDS       T05929                                 
Name
(RefSeq) alpha-1-antitrypsin 1-6 isoform X1
  KO
K03984  alpha-1-antitrypsin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110324788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110324788
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110324788
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110324788
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110324788
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 110324788
NCBI-ProteinID: XP_021058143
Ensembl: MGP_PahariEiJ_G0029819
LinkDB
Position
7:complement(97888036..97895786)
AA seq 411 aa
MTTPFFSHGLLLLVGLCCLLLITKTKHEKLYEDPSIDPFQCRKVALTICNISISLFKKTA
QLSANGNILFSPIRVIAAISMLSLGANGNLSKHILETLRFNKTGLPEAEIHKCFQYLLHS
VHQPEEPSSLESGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDSSQAKTEINNYVM
EKSKKGIENIVKNLESNTFLTVVNYIIWNAKLVSDFGCLSVKVKDYHLGYGMTIKVPMIH
KVDMHYLFRVEDLSSTVLMLTLLTGNFATYFIIPDPGKMQKVEQSLTYPHFRRMRRQLLI
RMVDLEIPELSLSETHDLESVMSLLGITYVFNGGTNSSDMNDTLQKSFKVLSKAVLTIDA
KGAKPGTNPCFKKDRSTDMGRIQLNRPFLIFIQDQANDVPLFIGRVVNPQN
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgacaacaccctttttctcccatggactcctcctgctagtaggcttgtgctgtctgctt
ctcataaccaagactaaacatgaaaaactctatgaagacccaagcattgatcccttccag
tgccggaaggtggctctcaccatctgcaatatctccatctccttgttcaaaaagacggcc
caactgtcagcaaatggaaatattttattctcccctattagagtcattgctgccatttca
atgctgtccctgggagccaatggcaatttaagcaaacacatcctggagaccctaaggttc
aacaaaacaggcttgcctgaagcggagatccacaagtgtttccagtatctgctccattct
gtccaccagcctgaagagccatcatcactagaaagtggcagcagcgtgttcatccaccag
gacctgacatcagtagacaaattcgtgaaaggagtcaaggacctataccattctgacatg
atctccataaactttacagacagcagtcaagccaagacagagatcaacaattacgtgatg
gaaaaaagcaagaagggaatagagaacattgttaagaatctggagagtaacacgttcctg
actgtggtgaactacattatctggaatgccaaactcgtcagcgactttggctgcctgtcc
gtcaaagtgaaggactaccacttaggatacggcatgacgatcaaggtaccgatgatccat
aaggtggacatgcattacttgttccgagtcgaggatctgtctagcacagtgctgatgctt
actctgctcacaggcaacttcgcaacctacttcatcatacctgatccagggaagatgcag
aaggtcgaacagagtctgacctacccacacttccgccggatgagacgacaactattgata
aggatggttgatttagagataccagaactatcattgtctgagacccacgacttggagtca
gtgatgagtctattaggaatcacctacgttttcaacggtggcaccaacagctctgacatg
aatgacacacttcagaagtccttcaaggtgctaagtaaggccgtgttgaccatcgatgca
aagggggcaaagcctgggacaaacccatgctttaaaaaggacagatcgactgatatgggt
cggattcagctcaacagacctttcctgatcttcatccaggatcaagcgaatgatgtcccc
ctctttataggcagagtggtaaatccccaaaactaa

DBGET integrated database retrieval system