KEGG   Mus pahari (shrew mouse): 110324646
Entry
110324646         CDS       T05929                                 
Symbol
Adcy3
Name
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04740  Olfactory transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110324646 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110324646 (Adcy3)
   04371 Apelin signaling pathway
    110324646 (Adcy3)
   04020 Calcium signaling pathway
    110324646 (Adcy3)
   04072 Phospholipase D signaling pathway
    110324646 (Adcy3)
   04024 cAMP signaling pathway
    110324646 (Adcy3)
   04022 cGMP-PKG signaling pathway
    110324646 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110324646 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110324646 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110324646 (Adcy3)
   04062 Chemokine signaling pathway
    110324646 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    110324646 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    110324646 (Adcy3)
   04912 GnRH signaling pathway
    110324646 (Adcy3)
   04913 Ovarian steroidogenesis
    110324646 (Adcy3)
   04915 Estrogen signaling pathway
    110324646 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    110324646 (Adcy3)
   04921 Oxytocin signaling pathway
    110324646 (Adcy3)
   04926 Relaxin signaling pathway
    110324646 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    110324646 (Adcy3)
   04918 Thyroid hormone synthesis
    110324646 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    110324646 (Adcy3)
   04916 Melanogenesis
    110324646 (Adcy3)
   04925 Aldosterone synthesis and secretion
    110324646 (Adcy3)
   04927 Cortisol synthesis and secretion
    110324646 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110324646 (Adcy3)
   04270 Vascular smooth muscle contraction
    110324646 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    110324646 (Adcy3)
   04971 Gastric acid secretion
    110324646 (Adcy3)
   04972 Pancreatic secretion
    110324646 (Adcy3)
   04976 Bile secretion
    110324646 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110324646 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110324646 (Adcy3)
   04727 GABAergic synapse
    110324646 (Adcy3)
   04725 Cholinergic synapse
    110324646 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    110324646 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    110324646 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    110324646 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    110324646 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    110324646 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110324646 (Adcy3)
   04714 Thermogenesis
    110324646 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324646 (Adcy3)
   05207 Chemical carcinogenesis - receptor activation
    110324646 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110324646 (Adcy3)
   05163 Human cytomegalovirus infection
    110324646 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    110324646 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110324646 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110324646 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110324646 (Adcy3)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110324646 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 110324646
NCBI-ProteinID: XP_021057978
Ensembl: MGP_PahariEiJ_G0029340
LinkDB
Position
7:3430603..3469233
AA seq 967 aa
MAGGGTLRLRAHGFGPQLDSEVRKPRAQITFCVAYSFAFLSFVLGNQILANVFLYLCAII
VGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKD
ESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKY
HQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTG
TVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSR
CDYLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPASSKPSSPALIETKEPNGSAP
ASGSTSEEAEEQEVGADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILMDPWLVT
NYVTFVVGEALLLILTICSMAAIFPRSFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMA
NVVDMLSCLQYYMGPYNVTAGMELDGGCMGNPKYYNYVAVLSLIATIMLVQVSHMVKLTL
MLLVTGAVTAINLYAWCPVFDEYDHKRFQEKDFPMVALEKMQVLATPGLNGTDSRLPLVP
SKYSMTVMMFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLP
EHVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIIS
DFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLA
DFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMEST
GVMGNIQVVEDTQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLP
HQVVDNP
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggcgggaggaggaaccttaaggttgagagcccatggcttcggaccacagctagacagt
gaggtgaggaagcctcgcgctcagatcactttctgtgtggcttactcttttgcctttctt
tcatttgttcttggcaatcagatcctggccaacgtcttcctctacctatgtgctatcatt
gtgggcatcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcc
cgccagtcactggaggtgaagatgaatctggaggagcagagccagcagcaggaaaacctt
atgctttccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggat
gagagccagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaatgtc
agcatcctgtttgcagatattgtgggctttacccagctgtcctccgcttgtagcgcccag
gagctagtgaagctactcaacgagctctttgcccgctttgacaagctggcagccaaatac
caccagctgaggatcaagatcctaggcgactgttactattgcatctgcggcctgcctgac
taccgggaggaccacgccgtgtgctccatccttatggggcttgccatggttgaggccatc
tcgtacgtgcgagaaaagaccaagactggagtggacatgcgtgtgggagtgcacacgggc
actgtcctaggtggtgtcctgggccagaagcgctggcagtatgatgtatggtctactgat
gtcaccgtggcaaacaagatggaggctggtggcatcccagggcgcgtgcacatttcccag
agcaccatggactgcctgaagggggagtttgatgtggagcctggtgatgggggcagtcgc
tgtgactacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagag
gtgaagaaaacagcccaaaatggcctcaacggctcggccctgccaaatggagcgccggca
tcctccaaacccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccct
gccagcggctccacatcagaggaggctgaagaacaggaggtgggtgctgacaacccctcg
ttccccaacccccgccgcaggctgcgcctccaggacctggcagaccgcgtggtggacgcc
tctgaggatgagcacgaactgaaccagctgcttaacgaggccctgctggagcgggagtcc
gcccaggtggtaaagaagagaaacacattcctcctaaccatgaggttcatggacccagag
atggaaacacgctactcggtggagaaggagaagcagagtggggccgccttcagctgctcc
tgtgtggtcctcttctgcacggccatggtggagatactcatggacccctggctggtgaca
aactacgtgacctttgtggttggggaggctttgctcctgatcctgactatctgctcgatg
gctgccatctttcccaggtcatttcccaagaagctcgtggccttctcatcttggattgac
cggacccgctgggcaaggaacacctgggccatgttagccatcttcattctggttatggcc
aatgttgtggatatgcttagctgtctccaatactacatgggaccttacaacgtgacagcc
gggatggagctggacggcggctgtatggggaaccccaagtactacaactacgttgctgtg
ctgtcgcttatcgccaccatcatgctggtgcaggtcagccacatggtaaagctgacactc
atgctgctcgtcacaggcgccgtgactgccatcaacctgtatgcctggtgtcctgtcttt
gatgaatacgaccacaagcgctttcaggaaaaggactttcctatggtggccttagagaag
atgcaggtacttgccacccctgggctcaatggcactgacagcaggctgcccctggtgcct
tccaagtactcaatgactgtgatgatgttcatcatgatgctgagcttttactacttctca
cgtcacgtggaaaaactggcccgaacactgttcttgtggaagattgaggtccatgaccag
aaagaacgtgtctacgagatgcgccgatggaatgaggccttggtcaccaacatgttgcct
gagcatgttgcacgccatttcctggggtccaagaagagagatgaggagctgtacagccag
tcttatgacgagattggagtcatgtttgcctccttgcccaactttgccgacttctacact
gaggagagcatcaacaatggtggcatcgagtgtcttcgcttcctcaatgagatcatctct
gattttgactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaactatt
ggcagtacctatatggcagcttcaggagtcacaccagatgtcaacaccaatggcttcacg
agctccagcaaggaggagaagtcagacaaggagcgctggcagcacctggctgacctggcc
gactttgcattagccatgaaagacacgctcacaaacatcaacaaccagtcattcaacaac
ttcatgctgcgcataggcatgaacaaaggaggggttctggctggtgtcattggagcccgg
aaaccacactatgacatctggggcaatacggtcaatgtggccagcaggatggaatccaca
ggagtcatgggcaacatccaggtggtagaagacacacaggtcatccttcgagagtatggc
ttccgctttgtgaggcgaggtcccatctttgtgaaaggcaaaggggaacttctgaccttt
ttcttgaagggacgggacaggccagctgccttccccaatggctcctctgttacactgccc
caccaagtggtggacaacccctga

KEGG   Mus pahari (shrew mouse): 110325439
Entry
110325439         CDS       T05929                                 
Symbol
Adcy4
Name
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110325439 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110325439 (Adcy4)
   04371 Apelin signaling pathway
    110325439 (Adcy4)
   04020 Calcium signaling pathway
    110325439 (Adcy4)
   04072 Phospholipase D signaling pathway
    110325439 (Adcy4)
   04024 cAMP signaling pathway
    110325439 (Adcy4)
   04022 cGMP-PKG signaling pathway
    110325439 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110325439 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110325439 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110325439 (Adcy4)
   04062 Chemokine signaling pathway
    110325439 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    110325439 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    110325439 (Adcy4)
   04912 GnRH signaling pathway
    110325439 (Adcy4)
   04913 Ovarian steroidogenesis
    110325439 (Adcy4)
   04915 Estrogen signaling pathway
    110325439 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    110325439 (Adcy4)
   04921 Oxytocin signaling pathway
    110325439 (Adcy4)
   04926 Relaxin signaling pathway
    110325439 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    110325439 (Adcy4)
   04918 Thyroid hormone synthesis
    110325439 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    110325439 (Adcy4)
   04916 Melanogenesis
    110325439 (Adcy4)
   04925 Aldosterone synthesis and secretion
    110325439 (Adcy4)
   04927 Cortisol synthesis and secretion
    110325439 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110325439 (Adcy4)
   04270 Vascular smooth muscle contraction
    110325439 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    110325439 (Adcy4)
   04971 Gastric acid secretion
    110325439 (Adcy4)
   04972 Pancreatic secretion
    110325439 (Adcy4)
   04976 Bile secretion
    110325439 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    110325439 (Adcy4)
   04727 GABAergic synapse
    110325439 (Adcy4)
   04725 Cholinergic synapse
    110325439 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    110325439 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    110325439 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    110325439 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    110325439 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    110325439 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110325439 (Adcy4)
   04714 Thermogenesis
    110325439 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325439 (Adcy4)
   05207 Chemical carcinogenesis - receptor activation
    110325439 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110325439 (Adcy4)
   05163 Human cytomegalovirus infection
    110325439 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    110325439 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110325439 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110325439 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110325439 (Adcy4)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110325439 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N CD52
Other DBs
NCBI-GeneID: 110325439
NCBI-ProteinID: XP_021059104
Ensembl: MGP_PahariEiJ_G0030336
LinkDB
Position
8:complement(46872935..46887809)
AA seq 1072 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCALVALPAVAWASGRELTSDPS
FLTTVLCAFGGFSLLLGLASREQQLQRWTRPLSGLIWVALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWQLESQRALLPQLAANAVL
FLCGNVVGAYHKALMEQALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQHSGPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRQLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLDLLAG
AYAVERADAEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHPMRPSLLMTR
YLESWGAAKPFAHLSHLDSPVSTSTPLPEKAFSPQWSLDRSRTPRGLDDELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQM
LVTARPPSLIITYSITFLLFFLLLFVCFSEHLTKCVQKGPKMLHWLPALSVLVATRPGFR
VALGTATILLVFTMAIASLLFLPVSSDCLFLASNVSSVTFNASWELPGPLPLISIPYSMH
CCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYQSPLDSRPG
VLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDAERSCSHLGTMVEFA
VALGSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARALQSLGYTCYSRGSIKVKGKGELCTYFLNTDLTRTGSPSAS
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggctcgcctcttcagtccccggcctcctcccagcgaagatctcttctatgagacttac
tacagcctgagccaacagtacccactgctgatactgcttttggtcattgtgctctgcgcg
ctcgtggcactgcccgccgtcgcctgggccagcggcagggagctgacttcagacccaagc
ttcctgacaactgtgctgtgtgcttttggtggcttctctctgttattgggactcgcttcc
cgggagcagcaactgcagcgatggacacgacctctttccggtctcatatgggttgcattg
ctggctctgggttatggatttctgttcactgggggtgtggtgagcgcctgggaccaggtg
tcttttttcctcttcatcatcttcaccgtgtacgccatgctgcccttgggcatgcgggat
gctgctgctgcgggggtcatctcatccctctcgcacctgctggtccttggactgtatctt
gggtggcagcttgagtcacagagagctctgctaccacagttggcagcaaacgcggtgttg
ttcctgtgtgggaacgtggtgggggcgtaccacaaggccctgatggagcaagcactgcgg
gccacgttccgggaggctcttagctctctgcattcacgccggaggttggacactgagaaa
aagcaccaggagcacctcctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcccggctgcaggctggacagcactcagggccagagaacacaaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtgagcgtgctgtatgccgacatcgtg
ggcttcacgcggctggccagcgagtgttccccgaaggagctggtcctcatgctgaacgag
ctctttggcaagttcgaccaaattgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgcccctctcgctgcctgaccacgctatcaat
tgtgtgcgcatgggactggacatgtgccgggccatcaggcaacttcgggtagccaccggt
gtggatatcaacatgcgcgtgggcgtgcactcgggcagcgttctttgtggagtcatcggg
ctacagaagtggcagtatgatgtctggtcccacgatgtcacattggccaaccatatggaa
gctggcggtgtaccaggacgagtgcacatcacaggggccacgctggacctgctagcagga
gcttatgctgtggagagggcagacgcagaacaccgagacccgtaccttcgggagctaggc
gaacctacatacctggtcattgatcctcgggctgaggaggaagacgagaagggcaccgca
aaaggattgctgtcttctctggaggggcacccgatgcgtccgtcacttctgatgactcgc
tatctggagtcttggggtgcagccaagcctttcgcccacctaagccaccttgacagtccc
gtgtccacctccactccactcccggagaaagccttcagcccccagtggagcctggaccgg
agtcgcactccccggggactggacgatgagctggacactggcgatgccaagttcttccag
gtcatcgaacaactcaactctcagaaacagtggaagcagtcaaaggacttcaacctcctg
acgttgtacttcagagagaaggagatggagaaacagtatcggctctctgcactccccgcc
ttcaaatactacgcagcctgcaccttcctggtttttctgtccaacttcactatccaaatg
ctggtgacagccaggcccccatctctgatcatcacctacagcatcaccttccttctcttc
tttctcctcctgttcgtctgcttctcagagcacctgacgaagtgtgtccagaaaggtccc
aagatgttgcactggttgcctgcactgtctgtcctggtggccacacggccaggatttcga
gtagccctgggcacggccaccatcctcttggtattcactatggccatcgccagcctgctc
ttcttaccagtgtcatcagactgccttttcctggcttccaatgtgtcctctgtgactttc
aatgcttcctgggagctgccaggacccctgcctctcatcagcatcccatactccatgcat
tgctgcgtgttgggtttcctctcctgctccctttttctgcacatgagcttcgaactgaag
ctgctcctgcttctgctgtggctggtggcatcttgttccctatttctgcattcccacgcc
tggctgtccgactgcctcattgcccgcctttatcaaagccctttggactccaggccaggg
gtactgaaggaacccaagctgatgggagctatctacttcttcatcttcttcttcacgctt
ctggtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaaaaagaaa
ctgaggcaggagcgagaggagactgagacgatggagaacctgacccggctcctcctggag
aatgtactccctgcacacgtggccccccagttcatcggccagaaccggcgcaatgaggac
ctctaccaccagtcgtacgaatgtgtttgtgtcctcttcgcatcggtcccagactttaag
gaattctactctgaatccaacatcaaccacgaggggctggagtgcctgcggctgctcaat
gagatcattgctgactttgatgagctgctctccaagccaaagttcagtggagtagagaag
atcaaaactattggcagtacctacatggctgccacaggcttaaatgctacctctggacag
gatacgcaacaggatgctgagagaagctgcagtcacctgggcaccatggtggaatttgca
gtggccctggggtctaagctgggcgtcatcaacaagcactcgttcaacaacttccgcctg
cgtgtggggttgaaccatggaccagtagtagcaggagtgattggggcgcagaagccacag
tatgacatctgggggaacacagtgaatgtggccagccgcatggagagcacaggcgttctc
ggcaagatccaagtgacagaggagacagctcgggccctgcagtccctgggttacacgtgc
tacagcagaggcagtatcaaggtcaaaggcaaaggggaactctgtacctacttcctgaat
acagacctgacgaggaccggatctccctcggcatcctag

KEGG   Mus pahari (shrew mouse): 110328764
Entry
110328764         CDS       T05929                                 
Symbol
Adcy2
Name
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110328764 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110328764 (Adcy2)
   04371 Apelin signaling pathway
    110328764 (Adcy2)
   04020 Calcium signaling pathway
    110328764 (Adcy2)
   04072 Phospholipase D signaling pathway
    110328764 (Adcy2)
   04024 cAMP signaling pathway
    110328764 (Adcy2)
   04022 cGMP-PKG signaling pathway
    110328764 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110328764 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110328764 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110328764 (Adcy2)
   04062 Chemokine signaling pathway
    110328764 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    110328764 (Adcy2)
   04922 Glucagon signaling pathway
    110328764 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    110328764 (Adcy2)
   04912 GnRH signaling pathway
    110328764 (Adcy2)
   04913 Ovarian steroidogenesis
    110328764 (Adcy2)
   04915 Estrogen signaling pathway
    110328764 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    110328764 (Adcy2)
   04921 Oxytocin signaling pathway
    110328764 (Adcy2)
   04926 Relaxin signaling pathway
    110328764 (Adcy2)
   04935 Growth hormone synthesis, secretion and action
    110328764 (Adcy2)
   04918 Thyroid hormone synthesis
    110328764 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    110328764 (Adcy2)
   04916 Melanogenesis
    110328764 (Adcy2)
   04925 Aldosterone synthesis and secretion
    110328764 (Adcy2)
   04927 Cortisol synthesis and secretion
    110328764 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110328764 (Adcy2)
   04270 Vascular smooth muscle contraction
    110328764 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    110328764 (Adcy2)
   04971 Gastric acid secretion
    110328764 (Adcy2)
   04972 Pancreatic secretion
    110328764 (Adcy2)
   04976 Bile secretion
    110328764 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110328764 (Adcy2)
   04727 GABAergic synapse
    110328764 (Adcy2)
   04725 Cholinergic synapse
    110328764 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    110328764 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110328764 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    110328764 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    110328764 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110328764 (Adcy2)
   04714 Thermogenesis
    110328764 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328764 (Adcy2)
   05207 Chemical carcinogenesis - receptor activation
    110328764 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110328764 (Adcy2)
   05163 Human cytomegalovirus infection
    110328764 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    110328764 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110328764 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110328764 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110328764 (Adcy2)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110328764 (Adcy2)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N HNOBA
Other DBs
NCBI-GeneID: 110328764
NCBI-ProteinID: XP_021063855
Ensembl: MGP_PahariEiJ_G0015769
LinkDB
Position
11:complement(760034..1144346)
AA seq 1095 aa
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMG
SCLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWIC
LVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVY
LSATAGAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFE
KRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADI
VGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAK
NCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
EAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHL
FRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQ
NRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLFFYNKNIEKEYRATA
LPAFKYYVTCACLIFLCIFIVQILVVPKTSILGFSFGAAFLSLIFILFVCFAGQLLQCSK
KASASLMWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANASN
TNVSAPDNQTAILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNII
LLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKN
KFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDF
KEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPS
QEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFV
NTEMSRSLSQSNLAS
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcggcgccgctacctgcgggaccgcgccgaggcggcggcg
gcagcggcggcgggcggcggcgaggggctgcagcggtcccgggactggctctacgagtcc
tactactgcatgagccagcagcaccctctcatcgtcttcctgctgctcatcgtcatgggc
tcctgcctcgccctgcttgccgttttcttcgcgctcgggctggaggtggaagaccacgtg
gcatttttaataaccgttcccactgccctggccatcttcttcgccatattcattcttgtc
tgcatcgagtctgtgttcaagaagctgctccgtgtgttctcgctggtgatttggatatgt
ctggttgccatgggatacctgttcatgtgctttggagggaccgtgtccgcctgggaccag
gtgtcattcttcctcttcatcatcttcgtggtgtacaccatgcttcccttcaacatgcgg
gacgccatcattgccagcgtcctcacctcttcatctcatacaatagtgctgagtgtctac
ctgtctgcaacagcaggggccaaggagcacctattctggcagatactggccaacgtgatc
attttcatctgtgggaacttggcaggagcttaccataagcacctcatggaacttgccctg
cagcaaacctatcgggacacatgtaattgcatcaagtcccggatcaagctggaatttgaa
aaacggcagcaggaacggcttctgctttccttgctgccggctcacatcgccatggagatg
aaggctgaaatcattcagaggctgcaggggcccaaagcaggacagatggaaaacacgaac
aacttccacaacctgtatgtcaaacgacacaccaatgtgagcatattatacgctgacatt
gttggcttcacccgcctcgcaagcgactgctcccctggcgaactggtccacatgctcaat
gaactctttgggaagttcgatcaaatcgcaaaggagaatgagtgcatgagaattaaaatt
ttaggagactgctattactgtgtttccgggctccctatatctctccctaaccatgccaag
aactgtgtgaaaatgggactggatatgtgcgaagccataaagaaagtgagagatgctacc
ggggtcgatatcaacatgcgtgtgggagtgcattctgggaacgttctctgtggtgtgatt
ggtctccagaagtggcagtatgacgtgtggtctcatgatgttactttggccaaccacatg
gaagctggaggagtccctggacgtgttcacatttcctcagtcactctggagcacttgaat
ggggcttataaagtggaggaaggagacggtgagataagagacccatatttaaagcagcat
ttggtgaaaacctactttgtaatcaaccccaagggagaaagacggagtcctcagcatctc
ttcagacctcgacacactctggatggagcgaagatgagagcatctgtccgcatgacccgg
tacttggagtcctggggagcggccaagccgtttgcacatctgcaccacagagatagcatg
accacagagaatgggaagattagcaccacggatgtgccaatgggtcaacataattttcaa
aatcgcaccttaagaactaagtcacagaagaagcgattcgaagaagaactgaatgaaagg
atgatccaagcaattgatgggatcaacgcacagaagcagtggctcaagtcagaagacatt
caaagaatctccctgtttttctataacaaaaatatagaaaaagaataccgagccactgca
ctgccagcattcaagtactacgtgacctgtgcctgcctcatcttcctctgcatcttcatt
gtacagattcttgtagtgccaaaaacgtccatccttggcttctcctttggagctgcattt
ctctccctcatcttcatcctctttgtctgcttcgctggacagcttttgcaatgcagcaaa
aaggcctctgcctctctcatgtggcttttgaaatcatcaggcatcatagccaaccgccca
tggccacggatctccctcacgatcgtcaccacggctatcatcctaaccatggctgtgttc
aacatgtttttcctgagcaactctgaggagacaacccttccaactgccaatgcatcaaat
acaaacgtttctgccccagataaccagacagcgattcttcatgcacgaaacttgtttttt
cttccgtacttcatatacagctgcatcctgggattgatctcctgctccgttttcctgagg
gtgaactacgagttgaaaatgttaatcatgatggtggcactcgtgggctacaacatcatt
ctgctccacacccatgcccatgtcctggatgcatacagccaggtcctgtttcagagacca
ggcatttggaaagatctgaagaccatgggctctgtgtccctctctatattcttcatcacg
ctgctcgttctggggagacagagtgaatattactgtaggttagacttcttgtggaagaac
aagttcaaaaaagagcgggaggagatcgaaaccatggagaacctaaaccgagtgctgctg
gagaacgtgcttcctgcccacgtggctgaacacttcctggccaggagcctgaaaaacgag
gagttataccaccagtcctacgattgtgtctgcgtcatgtttgcctccattccggacttc
aaggaattctacacggagtcagatgtgaacaaggaaggcttggaatgcctccgcctcctg
aatgagatcatcgctgactttgatgacctgctttccaagcccaagttcagtggtgttgaa
aagatcaagaccattggtagcacatacatggccgccacaggtctgagtgctgtacccagc
caggagcatgcccaggaacccgagcgtcagtacatgcacataggcaccatggtggagttt
gcatacgccctggtgggaaaactggatgccatcaataagcactccttcaacgacttcaaa
cttcgagtgggtatcaaccatggacctgtaatagccggcgtcataggagctcagaagcca
caatatgacatctggggcaacactgtcaacgttgccagcaggatggacagtaccggggtc
ctggacaaaatacaggtgactgaggagacaagcctcatcctgcagacgcttggctacacg
tgtacgtgtcgaggtatcatcaacgtgaaggggaaaggggacctgaagacgtactttgta
aacaccgagatgtcaaggtccctttctcagagcaacttggcttcctga

KEGG   Mus pahari (shrew mouse): 110329393
Entry
110329393         CDS       T05929                                 
Symbol
Adcy5
Name
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05012  Parkinson disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05032  Morphine addiction
mpah05034  Alcoholism
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110329393 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110329393 (Adcy5)
   04371 Apelin signaling pathway
    110329393 (Adcy5)
   04072 Phospholipase D signaling pathway
    110329393 (Adcy5)
   04024 cAMP signaling pathway
    110329393 (Adcy5)
   04022 cGMP-PKG signaling pathway
    110329393 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110329393 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110329393 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110329393 (Adcy5)
   04062 Chemokine signaling pathway
    110329393 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    110329393 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    110329393 (Adcy5)
   04912 GnRH signaling pathway
    110329393 (Adcy5)
   04913 Ovarian steroidogenesis
    110329393 (Adcy5)
   04915 Estrogen signaling pathway
    110329393 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    110329393 (Adcy5)
   04921 Oxytocin signaling pathway
    110329393 (Adcy5)
   04926 Relaxin signaling pathway
    110329393 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    110329393 (Adcy5)
   04918 Thyroid hormone synthesis
    110329393 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    110329393 (Adcy5)
   04916 Melanogenesis
    110329393 (Adcy5)
   04924 Renin secretion
    110329393 (Adcy5)
   04925 Aldosterone synthesis and secretion
    110329393 (Adcy5)
   04927 Cortisol synthesis and secretion
    110329393 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110329393 (Adcy5)
   04270 Vascular smooth muscle contraction
    110329393 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    110329393 (Adcy5)
   04971 Gastric acid secretion
    110329393 (Adcy5)
   04972 Pancreatic secretion
    110329393 (Adcy5)
   04976 Bile secretion
    110329393 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    110329393 (Adcy5)
   04727 GABAergic synapse
    110329393 (Adcy5)
   04725 Cholinergic synapse
    110329393 (Adcy5)
   04728 Dopaminergic synapse
    110329393 (Adcy5)
   04726 Serotonergic synapse
    110329393 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    110329393 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110329393 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    110329393 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    110329393 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110329393 (Adcy5)
   04714 Thermogenesis
    110329393 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329393 (Adcy5)
   05207 Chemical carcinogenesis - receptor activation
    110329393 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110329393 (Adcy5)
   05163 Human cytomegalovirus infection
    110329393 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110329393 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    110329393 (Adcy5)
   05031 Amphetamine addiction
    110329393 (Adcy5)
   05032 Morphine addiction
    110329393 (Adcy5)
   05034 Alcoholism
    110329393 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110329393 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110329393 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110329393 (Adcy5)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110329393 (Adcy5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc Adcy_cons_dom HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 110329393
NCBI-ProteinID: XP_021064663
Ensembl: MGP_PahariEiJ_G0016403
LinkDB
Position
12:30155535..30306639
AA seq 1262 aa
MSGSKSVSPPGYAAQTAASPAPRGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAGGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVELGLEERRGKGRAAEELEPGTGT
VEDGDGSEDGGSSVASGSGAGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARLPLQIAYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRQCIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSLFMLSFYLSCFLLLALVVFVSVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGNEQGFCGS
PQPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIEFIYVLIVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKTGKTHIKAIADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcggcgtcgccg
gcgccccggggaggcccagagcatcgcgccgcttggggagaagccgattcccgcgccaac
ggctacccccacgcccccgggggatcgacccgcggctccaccaagagatctgggggagcg
gtgaccccacaacagcagcagcgcctggccagccgttggcgcggtggcgacgacgacgaa
gaccctccactaagcggtgatgaccctctggctgggggctttggcttcagcttccgctct
aagtccgcctggcaggagcgcggtggcgacgacggcggtcgcggcagcaggcggcagcgg
cggggcgcggctggagggggcagcacccgggcgccccctgcgggcggcagcggcagttcg
gcggcggccgcagcggccgcaggtggcacggaggtgcgcccccgctcggtggagctaggc
ctggaggagcgtcgaggaaaaggccgcgcggccgaggagctggagcccgggactggcacc
gtcgaggatggagacgggtccgaggatggaggcagttccgtggcgtcaggctctggggcc
ggcgcggtgctgtcgttgggcgcctgctgcctggccttgctgcagattttccgctctaag
aagttcccgtcggacaaactggagcgtctgtaccagcgctacttcttccgcctgaaccag
agcagtctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgctggctttc
cacgcggcgcggctcccgctccagatagcctacctggccgtgttggcagctgccgtgggc
gtgatccttatcatggccgtgctctgcaaccgtgcagcgttccaccaggaccacatgggc
ctggcctgctatgcgctcattgcagtggtgctggccgtccaggtagtaggcctgttgctg
ccacagccacgcagcgcctccgagggtatctggtggaccgtgttcttcatctataccatc
tacaccctgctgcctgtgcgcatgagggctgcggtgctcagcggggtgcttctgtcggct
ctccacttggccatctctctgcacaccaacgcccaggaccagtttctgctgaaacagctt
gtctccaatgtcctcatcttctcctgcaccaacattgtgggtgtgtgcactcactaccca
gctgaggtctcccagagacaggccttccaggagacccgtcagtgtatccaggctcggctc
cattcccagcgggagaaccagcaacaggagcggctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccacaag
atttacatccagaagcatgacaatgtgagcatcctgtttgccgacatcgagggcttcacc
agcctggcttcccagtgtactgcccaagaactggtcatgaccctcaatgagctcttcgcc
cgctttgacaagttggctgcggagaatcactgtttacggattaagatcctcggggattgt
tactactgtgtctccgggctgcctgaagccagagctgaccacgcccactgctgcgtggag
atgggaatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgtgtggggattcacagcgggagagtacactgcggtgtccttggtctcagaaag
tggcaattcgacgtgtggtctaacgatgtcactctggccaaccacatggaagctggtggc
aaggcgggacgcatccacatcaccaaggccacactcaactacctgaatggggactatgag
gtggagccaggctgtggtggcgagcgcaatgcctacctcaaggagcacagcattgagacc
ttcctcatcctgcgctgtacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcggacacaatccgcctcactggggagccgagcgtccc
ttctacaaccacctgggcggcaaccaggtgtccaaagagatgaagaggatgggctttgag
gaccccaaggacaagaacgcccaggaaagtgcgaacccggaggatgaagtggacgagttc
ctgggtcgggccatcgatgccaggagcatcgacagactgcgatctgaacacgtccgcaag
ttcctcctgaccttcagggagcccgacttagagaagaagtattccaaacaggtggatgac
cgatttggtgcctatgtggcctgcgcctcgcttgttttcctcttcatctgctttgtccag
atcaccattgtgccccactccctgttcatgctgagtttctacctgtcgtgtttcctgctg
ctggccttggtggtgtttgtgtctgtgatctacgcctgtgtgaagctcttccccactccc
ctgcagacactctctaggaagatagtgcgatccaagaagaacagcaccctggtcggggtg
ttcaccatcaccctcgtgttcctctcggcttttgtcaacatgttcatgtgcaactctaag
aacctggtgggctgcctggcagaggagcacaacatcacggtgaaccaggtcaacgcatgt
catgtgatggagtcggccttcaactacagcctgggcaacgagcagggcttctgtggcagc
ccccagcccaactgcaacttcccagagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatc
gagttcatctatgtgctcatcgtggaggtgcccggcgtcacactcttcgacaacgccgac
cttctggtcaccgccaatgccatagacttcagcaacaacgggacctcccagtgccctgag
catgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctctgtcttcgtgctc
gctctgtatctgcatgcacagcaggtggagtccactgctcgccttgacttcctctggaaa
ctgcaggccacagaagagaaggaggagatggaggagctgcaggcctacaaccggcgcctg
ctgcacaacattctgcccaaggacgtcgctgcccacttcctggcccgggaacggcgcaat
gacgagctgtactaccaatcgtgcgagtgtgtggctgtcatgtttgcctccattgccaac
ttctccgaattctacgtggagctagaggccaacaacgagggtgtcgagtgcctacggctg
ctcaatgagatcatcgcagactttgatgagatcatcagtgaggatcggttcaggcagctg
gaaaagatcaagaccataggtagcacctacatggctgcttctggcctcaatgactccacc
tatgacaagacaggcaagacccacatcaaggctattgcagacttcgccatgaagctgatg
gatcagatgaagtacatcaatgagcactccttcaacaactttcagatgaagattgggctc
aacattggacctgtagtggctggggtcattggggctcgcaagcctcagtatgacatctgg
ggcaatacagtgaatgtggccagccgaatggacagcactggggtgcctgatcgcatccag
gttactacagatatgtaccaggtgctggccgccaacacataccagctggagtgccggggt
gtggtcaaggtcaagggcaagggtgagatgatgacttacttcctcaatggagggcctccc
ctcagttag

KEGG   Mus pahari (shrew mouse): 110329624
Entry
110329624         CDS       T05929                                 
Symbol
Adcy9
Name
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110329624 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110329624 (Adcy9)
   04371 Apelin signaling pathway
    110329624 (Adcy9)
   04020 Calcium signaling pathway
    110329624 (Adcy9)
   04072 Phospholipase D signaling pathway
    110329624 (Adcy9)
   04024 cAMP signaling pathway
    110329624 (Adcy9)
   04022 cGMP-PKG signaling pathway
    110329624 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110329624 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110329624 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110329624 (Adcy9)
   04062 Chemokine signaling pathway
    110329624 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    110329624 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    110329624 (Adcy9)
   04912 GnRH signaling pathway
    110329624 (Adcy9)
   04913 Ovarian steroidogenesis
    110329624 (Adcy9)
   04915 Estrogen signaling pathway
    110329624 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    110329624 (Adcy9)
   04921 Oxytocin signaling pathway
    110329624 (Adcy9)
   04926 Relaxin signaling pathway
    110329624 (Adcy9)
   04935 Growth hormone synthesis, secretion and action
    110329624 (Adcy9)
   04918 Thyroid hormone synthesis
    110329624 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    110329624 (Adcy9)
   04916 Melanogenesis
    110329624 (Adcy9)
   04925 Aldosterone synthesis and secretion
    110329624 (Adcy9)
   04927 Cortisol synthesis and secretion
    110329624 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110329624 (Adcy9)
   04270 Vascular smooth muscle contraction
    110329624 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    110329624 (Adcy9)
   04971 Gastric acid secretion
    110329624 (Adcy9)
   04972 Pancreatic secretion
    110329624 (Adcy9)
   04976 Bile secretion
    110329624 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110329624 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110329624 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    110329624 (Adcy9)
   04727 GABAergic synapse
    110329624 (Adcy9)
   04725 Cholinergic synapse
    110329624 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    110329624 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110329624 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    110329624 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    110329624 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110329624 (Adcy9)
   04714 Thermogenesis
    110329624 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329624 (Adcy9)
   05207 Chemical carcinogenesis - receptor activation
    110329624 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110329624 (Adcy9)
   05163 Human cytomegalovirus infection
    110329624 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    110329624 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110329624 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110329624 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110329624 (Adcy9)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110329624 (Adcy9)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom DUF512 zf-C2HC_2
Other DBs
NCBI-GeneID: 110329624
NCBI-ProteinID: XP_021065031
Ensembl: MGP_PahariEiJ_G0016107
LinkDB
Position
12:complement(567164..694875)
AA seq 1354 aa
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKHCKYSISSSCSSSGDS
GGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFAVHMRSKVIVMVVPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLSGRVDSSNHTLTATPAADTCLSQVGSFSICIEVLFLLYTVMH
LPLYLSLFLGVVYSVLFETFSYHFRNEDCFPSPGPGALHWELLSRALLHVCIHAIGIHLF
VMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVK
RHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLL
NDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQE
KKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYL
DDRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRAKEFHCSCAEALLSGFEVIDDSQA
SSGPRGQGTASPGSVSDLAQTIKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCHDEPK
TSTKASGGPNSKTQNGLLSPPAEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKN
IREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKT
FASATFSSLLDVFLSTTVFLILSITCFLKYGATATPPPPAALAVFGADLLLEVLSLIVSI
RMVFFLEDVMICTKRLLEWIAGWLPRHCVGAILVSLPALAVYSHITSEFETNIHVTMFTG
SAVLVAVVHYCNFCQLSSWMRSSLATIVGAGPLLLLHISLCQDSSIVMSPLDSAQNFSAQ
RNPCNSSVLQDGRRPANLMGKELILAFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRT
KIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGK
ECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILF
EFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDT
TGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDNGVVPQHQLSIS
PDIRVQVDGSIGRSPTDEIANLVPSVQYSDKASLGSDDSAQTKEAHLSSKRPWREPVKAE
ERFPFGKAIEKDNCEDTGVEEANELTKLNVSKSV
NT seq 4065 nt   +upstreamnt  +downstreamnt
atggcttcctcaccccaccaacagctgctgcatcaccatagcaccgaggtgagctgcgac
tcaagcggagacagcaacagcgtgagggtcaagatcaaccctaagcagctgtcctccaac
acccacccgaagcactgcaagtacagcatctcctccagctgtagcagctcgggagactca
gggggccttccccggagggttggcggcgggggtcgcctgcgcagacagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaaattcgactccgtgaacctg
gaggaggcctgcctggagcgctgctttccgcagacccagcgccgcttccggtacgcactc
ttttatgtgggcttcgcctgccttctctggagcatctatttcgctgtccacatgagatcc
aaagtgattgtcatggtggtcccggctctgtgcttcctggtggtgtgtgtgggctttttc
ctgtttactttcaccaagctgtacgcccggcattatgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagtttcaggtttggacacctctgtcagga
cgtgttgacagctccaatcatactctcacagccacgccggcagcggacacttgcttatct
caagtgggaagcttctccatatgcatcgaagtgctctttttgctctacacggtcatgcat
ttacctctgtacctgagcttgtttttgggggtggtctattctgtcctttttgagaccttc
agctaccatttccgaaacgaagactgcttcccttccccaggccctggggccctgcactgg
gagctgctgagcagagccctgcttcacgtgtgcattcacgccatcgggatccatctgttt
gtcatgtctcaggtgaggtccaggagcacctttctcaaggtgggacagtccattatgcac
ggcaaagatctggaagtagagaaagccctgaaagagaggatgattcattccgtgatgccg
cggatcatcgcggatgacttaatgaaacagggggatgaggagagtgagaattccgtcaag
aggcacgccacctccagtcccaagaaccggaagaagaagtcctccatacagaaggcaccg
atagcattccgcccctttaagatgcagcagatagaagaagtcagtattttatttgcagac
attgtgggtttcaccaagatgagtgctaacaaatctgctcatgccttggtaggtctactc
aatgatctgtttggtcgctttgaccggctgtgtgaggagaccaagtgtgagaagatcagc
actctgggagactgttactattgtgtggcagggtgtccggagccccgggcagaccatgcc
tactgctgcattgaaatgggcttaggcatgataaaagccattgagcagttctgccaggag
aagaaagaaatggtgaacatgcgtgttggggttcacacggggactgtcctgtgtggcatc
ctgggcatgaggaggtttaaatttgatgtgtggtccaatgatgtgaacttggctaatctc
atggagcagctgggagtggctggtaaagttcacatatccgaggccactgcaaaatactta
gacgacaggtatgaaatggaagatgggagagttattgagcgccttgggcagagtgtggtt
gctgaccagctgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagttc
cactgcagctgtgcagaggccctgctttctggctttgaggtcattgacgactcacaggcg
tcctcaggccctaggggacaggggacagcatcgccagggagtgtcagtgatttggcgcag
actatcaaaacctttgataaccttaagacatgcccttcttgtggaatcacatttgctccc
aaatctgaagctggtgcggaaggaggagctgtgcaaaatggctgtcacgacgagcctaag
accagcaccaaggcttctggaggacccaactccaaaacccagaacggactcctgagccct
cctgcagaggagaagctcactaacagccagacctccctctgtgagatcctgcaggagaag
ggacggtgggcaggcgtgagcttggaccagtcagccctcctcccactcaggttcaagaac
atccgtgagaaaactgatgcccactttgttgatgtcatcaaagaagacagcctgatgaaa
gattatttcttcaagccgcccatcaatcagttcagcctgaacttcctggaccaggagctg
gagcgatcctacagaaccagctaccaggaagaggtcataaagaattctcctgtgaagaca
tttgccagtgccactttcagctcccttctggatgtgtttctgtcaaccaccgtgttcctg
attctctccatcacctgcttcctaaagtatggagccaccgccacccctcccccaccggct
gccctggccgtctttggtgcagacctgctgctggaggtgctttccctcatagtgtccatc
agaatggtgtttttcctagaggatgtcatgatatgcacaaagcggttgctggaatggatc
gctggctggctccctcgccactgcgttggggcaatcttggtgtcacttcctgccctggct
gtctattcacacatcacctctgagtttgagaccaacatacatgtcaccatgttcactggc
tctgcggtgctggtggccgttgtacactactgtaacttctgccagctcagctcctggatg
aggtcctctctcgccaccatcgtgggggctgggccactgcttctgctccacatctccctg
tgtcaggacagttccattgtgatgtcccccttggactcagcacagaatttcagtgcccag
aggaacccatgcaacagctcagtgctacaggatggcaggaggccggccaacctcatgggc
aaggaacttatcctcgccttcttcctcctgctcctcctggtctggttcctgaaccgggag
ttcgaggtcagctaccggctgcactaccatggggatgtggaggcagacttacaccgcacc
aagatccagagcatgagagaccaggctgactggctactgcggaacatcatcccctaccac
gtggctgagcagctcaaggtctctcagacctactccaagaaccatgacagtgggggagtc
atctttgccagcattgtcaacttcagtgaattctatgaggagaactatgaggggggcaag
gagtgctatcgtgtcctcaatgagctgatcggtgactttgatgagctcttgagcaagccg
gactataatagcatcgagaagatcaagaccatcggggccacatacatggcagcatcaggg
ctaaacacagcccagtgtcaggagggtggccacccacaggagcatctgcgtatcctcttc
gagttcgccaaggagatgatgcgcgtggtggatgacttcaacaacaatatgttatggttc
aacttcaagctcagggtcggctttaatcacggaccccttacggcaggtgtcatcggtacc
accaagctgctgtatgacatctggggggacaccgtcaacatcgccagcaggatggacacc
actggtgtggagtgccgtatccaggtgagtgaagagagctaccgcgtgctgagcaagatg
ggttatgactttgactaccgagggaccgtgaatgtcaaggggaaagggcagatgaagacc
tacctttacccaaagtgcatggacaacggagtggttccccagcaccagctgtccatctcc
ccagacatccgtgtccaggtggacggcagcattgggcggtctcccacggatgagatcgcc
aacttggtgccttccgttcagtattcggacaaggcttccctgggatctgatgacagcgcg
cagaccaaggaagcgcacctgtcctctaagaggccctggagagagccagtcaaagcagag
gaaaggtttccatttggcaaagccatagaaaaggacaactgtgaagacacaggagtagaa
gaggccaatgaactcaccaagctcaacgtctcaaagagtgtctga

KEGG   Mus pahari (shrew mouse): 110330584
Entry
110330584         CDS       T05929                                 
Symbol
Adcy1
Name
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110330584 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110330584 (Adcy1)
   04371 Apelin signaling pathway
    110330584 (Adcy1)
   04020 Calcium signaling pathway
    110330584 (Adcy1)
   04072 Phospholipase D signaling pathway
    110330584 (Adcy1)
   04024 cAMP signaling pathway
    110330584 (Adcy1)
   04022 cGMP-PKG signaling pathway
    110330584 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110330584 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110330584 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110330584 (Adcy1)
   04062 Chemokine signaling pathway
    110330584 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    110330584 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    110330584 (Adcy1)
   04912 GnRH signaling pathway
    110330584 (Adcy1)
   04913 Ovarian steroidogenesis
    110330584 (Adcy1)
   04915 Estrogen signaling pathway
    110330584 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    110330584 (Adcy1)
   04921 Oxytocin signaling pathway
    110330584 (Adcy1)
   04926 Relaxin signaling pathway
    110330584 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    110330584 (Adcy1)
   04918 Thyroid hormone synthesis
    110330584 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    110330584 (Adcy1)
   04916 Melanogenesis
    110330584 (Adcy1)
   04925 Aldosterone synthesis and secretion
    110330584 (Adcy1)
   04927 Cortisol synthesis and secretion
    110330584 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110330584 (Adcy1)
   04270 Vascular smooth muscle contraction
    110330584 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    110330584 (Adcy1)
   04971 Gastric acid secretion
    110330584 (Adcy1)
   04972 Pancreatic secretion
    110330584 (Adcy1)
   04976 Bile secretion
    110330584 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110330584 (Adcy1)
   04727 GABAergic synapse
    110330584 (Adcy1)
   04725 Cholinergic synapse
    110330584 (Adcy1)
   04720 Long-term potentiation
    110330584 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    110330584 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110330584 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    110330584 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    110330584 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110330584 (Adcy1)
   04714 Thermogenesis
    110330584 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110330584 (Adcy1)
   05207 Chemical carcinogenesis - receptor activation
    110330584 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110330584 (Adcy1)
   05163 Human cytomegalovirus infection
    110330584 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110330584 (Adcy1)
   05142 Chagas disease
    110330584 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    110330584 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110330584 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110330584 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110330584 (Adcy1)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110330584 (Adcy1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom HNOBA
Other DBs
NCBI-GeneID: 110330584
NCBI-ProteinID: XP_021066463
Ensembl: MGP_PahariEiJ_G0016808
LinkDB
Position
13:complement(22216951..22332195)
AA seq 1118 aa
MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELEALFRGYTLRLEQAAT
LKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLALFVVTNVRSLQVSQLQQ
VGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSAVAEQGVWQLLLVTFVSYALLPVRS
LLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRK
AFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDN
VSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLT
QPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSN
DVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTFLRTHNIETFFIVPSHR
RKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRT
ASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKY
HQLQDEYFTSAVVLALILAALFGLIYLLVIPQSVAVLLLLVFSICFLVACTLYLHITRVQ
CFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCLPWAWSSQSNSSLVVLAAGGRRTVLPA
LPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYILVLELSGYTKVGGGALS
GRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERGDMERVKLDNKRILFNLL
PAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEII
ADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDV
LDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVT
EEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSSHGRTFRLERRMLPYGRGG
GQARRPPLCPAAGPPVRPGLPPAPTSQYLSSTAAGKEA
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccaaggcggcggcggaggcgcgggcgagcccgggggcgca
gagcgggcggccgggccgggcggccggcgtgggttccgggcgtgtggcgaggagttcgcg
tgccccgagctggaggcgctgttccgcggctacacgttgcggctggagcaggcggccacg
ctgaaagcgctggctgtgctcagcctgctggcaggcgccctggcgctggctgagctgctg
ggcgcaccggggccagcgcccggcctcgccaaggggtcgcacccagtgcactgcatcctt
ttcctggcgctgttcgtggtcaccaatgtccgatccctgcaggtgtcccagctgcagcag
gtcggtcagctggcgctgttcttcagcctcaccttcgcgctactctgctgccccttcgcg
ctgggcggccccgcgaggagctctgcgggaggcgcaatgggctcggcggtcgccgagcaa
ggggtttggcaactccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgcagc
ctactggccatcggcttcgggctggtggtggctgcctcgcacttactggtcacagccgcc
ttggtccctgccaagcgcccacgtctctggaggacgctcggtgccaatgccctgctcttc
tttggtgtgaacatgtatggcgtcttcgtgcggatcttgacggagcgctcccagaggaag
gccttcctgcaggctcgaaactgcattgaggaccggctgcggctggaggatgagaatgag
aagcaggaacggttgctcatgagcctcttgccccggaatgtcgccatggagatgaaggaa
gacttcctgaagccccctgagaggatttttcacaagatttacatccagaggcatgacaat
gtgagcatcctgtttgcagacatcgtgggtttcacaggtctggcgtcccagtgcacggcc
caggagctggtgaaactgctcaatgaactctttggcaagttcgatgagttagccacggaa
aaccactgtcgccgaatcaagatccttggtgactgctactactgtgtgtctggccttacc
cagcccaagacggatcacgcccactgctgtgtggagatgggacttgacatgatcgatacc
atcacatccgtggctgaggctactgaagtagacctgaacatgcgtgtgggcctacacacc
ggcagggtcctctgtggtgtcctgggcctacggaagtggcagtatgacgtatggtccaat
gacgtgaccctggccaatgtcatggaggctgctggcttaccagggaaggtccacatcaca
aagacgaccctcgcgtgcttgaacggggactacgaggtggagccaggtcatggccatgag
aggaacacctttctgagaactcacaacattgagaccttctttattgtgccatcccatcgg
aggaagatattcccaggcttgattctctcggatatcaaaccagccaagaggatgaagttc
aagactgtctgctacctgctggtgcagctcatgcactgccggaagatgttcaaggctgag
atccccttctccaacgtgatgacctgcgaggatgacgacaagcggagggcattgagaaca
gcctcggaaaagctcagaaaccgttcgtctttctctacgaatgtggtctacaccactccc
ggtacacgtgtcaacaggtacatcagtcgtctcctcgaagcccgccagacagagctggag
atggctgatctgaacttctttaccctgaagtacaagcatgtggaacgagaacaaaaatac
caccagcttcaggacgagtacttcaccagcgccgttgtcctcgccctcatcctggctgcc
ttatttgggcttatctaccttctggtaatcccacagagtgtggctgtcctgctgctgctg
gtattttccatctgcttcttggtggcctgtaccctgtacctgcacatcacacgggtccag
tgttttccagggtgcctgacgatccagatccgcaccgccttgtgtgtgttcatagtggtc
ttaatctactcggtagctcagggctgtgtggtgggctgcctgccctgggcctggagctct
cagtccaacagttccctagtggtcctcgcagcgggtggccggcgcactgtgctgcctgcc
ctgccctgtgagtctgcacaccatgccctgctctgctgcctggtgggcaccctcccacta
gccatattcctgcgggtgtcctccttgccaaagatgatcctgctctctggactgactact
tcctacatccttgtcctggagctcagtggatacaccaaggttgggggtggtgccctctct
gggcgcagctatgagccaatcatggctatcctgctgttctcatgcacgctggccctgcac
gccaggcaagtggacgtcagactacgtctggactacctctgggcggcacaggcggaggag
gaacggggtgacatggagagagtcaagctggacaataagaggatcctcttcaatctcctg
ccagcccacgtcgcacagcacttcctcatgtccaatccccggaacatggacctctattac
cagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttctac
atagaactggatggcaacaacatgggtgttgagtgtctgcggctcctcaacgagatcatt
gccgactttgatgagctcatggacaaggacttctacaaggacctggagaagatcaagacc
attgggagtacttacatggctgccgtggggctggcgcccacagcaggaaccagggctaag
aagtccatctcgtcccacctgtgcacgctggcagacttcgccatcgacatgtttgatgtt
ctggatgaaatcaactaccagtcctacaacgactttgttctccgagttggcatcaacgtt
ggccccgtggttgctggagtgatcggtgctcgcaggccccagtacgacatctggggaaac
acagtcaacgtggccagtcggatggatagcactggggtccagggacgaattcaggtgact
gaggaagtccaccggctgctgaagaggtgctcataccagttcgtgtgcagaggcaaagtc
agcgtcaagggcaagggagagatgctaacgtactttctagaaggcaggactgatggaaac
agttcccacggcaggacctttcgcttggagcgaaggatgttaccttatgggagaggcgga
ggccaggccagacggcccccactgtgtcccgcggctggacccccagtcagaccagggctc
cctccagcccccactagccagtacctgtcttccacagcagcagggaaggaagcctag

KEGG   Mus pahari (shrew mouse): 110334500
Entry
110334500         CDS       T05929                                 
Symbol
Adcy6
Name
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04962  Vasopressin-regulated water reabsorption
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110334500 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110334500 (Adcy6)
   04371 Apelin signaling pathway
    110334500 (Adcy6)
   04072 Phospholipase D signaling pathway
    110334500 (Adcy6)
   04024 cAMP signaling pathway
    110334500 (Adcy6)
   04022 cGMP-PKG signaling pathway
    110334500 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110334500 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110334500 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110334500 (Adcy6)
   04062 Chemokine signaling pathway
    110334500 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    110334500 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    110334500 (Adcy6)
   04912 GnRH signaling pathway
    110334500 (Adcy6)
   04913 Ovarian steroidogenesis
    110334500 (Adcy6)
   04915 Estrogen signaling pathway
    110334500 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    110334500 (Adcy6)
   04921 Oxytocin signaling pathway
    110334500 (Adcy6)
   04926 Relaxin signaling pathway
    110334500 (Adcy6)
   04935 Growth hormone synthesis, secretion and action
    110334500 (Adcy6)
   04918 Thyroid hormone synthesis
    110334500 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    110334500 (Adcy6)
   04916 Melanogenesis
    110334500 (Adcy6)
   04924 Renin secretion
    110334500 (Adcy6)
   04925 Aldosterone synthesis and secretion
    110334500 (Adcy6)
   04927 Cortisol synthesis and secretion
    110334500 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110334500 (Adcy6)
   04270 Vascular smooth muscle contraction
    110334500 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    110334500 (Adcy6)
   04971 Gastric acid secretion
    110334500 (Adcy6)
   04972 Pancreatic secretion
    110334500 (Adcy6)
   04976 Bile secretion
    110334500 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110334500 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110334500 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    110334500 (Adcy6)
   04727 GABAergic synapse
    110334500 (Adcy6)
   04725 Cholinergic synapse
    110334500 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    110334500 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    110334500 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    110334500 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    110334500 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    110334500 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110334500 (Adcy6)
   04714 Thermogenesis
    110334500 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334500 (Adcy6)
   05207 Chemical carcinogenesis - receptor activation
    110334500 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110334500 (Adcy6)
   05163 Human cytomegalovirus infection
    110334500 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    110334500 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110334500 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110334500 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110334500 (Adcy6)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110334500 (Adcy6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom HNOBA TBK1_ULD GBR2_CC Shisa
Other DBs
NCBI-GeneID: 110334500
NCBI-ProteinID: XP_021071897
Ensembl: MGP_PahariEiJ_G0020241
LinkDB
Position
17:complement(63172525..63193290)
AA seq 1165 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRHANRASGFCTPRYMSCLKNVEPPSPTPAAHT
RCPWQDEAFRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAPDTSPRSGPSCWHRLV
RVFESKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLTFHAAPAQPQPAYVAL
LICASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAANPHSPSAGLWCPV
FFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNSSDPFLWKQLGANMVLFLCTNAIG
VCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKE
DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRI
KILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCG
VLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLK
EQCIETFLILGASQKRKEEKAMLAKLQRTRANSIEGLMPRWVPDRAFSRTKDSKAFRQMG
IDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSR
KVDPRFGAYVACALLVFCFICFIQLLVFPYSTLILGIYAAIFLLLLVTVLICAVCSCGSF
FPKALQRLSRNIVRSRVHSTAVGIFSVLLVFISAIASMFTCNHTPIRTCAARMLNLTPAD
VTACHLQQLNYSLGLDAPLCEGAAPTCSFPEYFVGNVLLSLLASSVFLHISSIGKLAMTF
VLGFTYLVLLLLGPPAAIFDNYDLLLGVHGLASSNETFDGLDCPAVERVALKYMTPVILL
VFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLAR
ERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEER
FRQLEKIKTIGSTYMAASGLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQM
KIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQL
ECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggttcccaaagtggatgaacggaaaacagcttggggg
gaacgcaatgggcagaagcgcccacgccacgcgaatcgagccagtggcttctgcacaccc
cgctacatgagctgcctcaagaatgtggagccacccagccccactcctgcggctcacact
cggtgcccctggcaggatgaagccttcaggagagcgggcccgggcaggggtgtggagctg
gggctgcggtcagtggccttggggtttgatgacactgaggtgaccacaccgatggggaca
gctgaagtggcaccggatacctcgcctcggagcggtccgtcctgctggcaccggctcgtg
cgggtgttcgagtctaagcagttccgctccgccaagctggagcggctgtaccagcggtac
ttcttccagatgaaccagagcagcctcacgctgctcatggcggtgctggtgctgctcatg
gctgtactgttgaccttccacgctgcgcctgctcagcctcagcctgcttacgtggccctg
ctgatctgtgcctccgtcctttttgtggtactcatggtggtgtgtaaccggcatagcttc
cgccaggactccatgtgggtggtgagctatgtggtcctgggcatcctagctgccgtgcaa
gtcgggggtgctctggcagccaatccgcacagcccctcggcgggcctttggtgccccgtg
ttcttcgtctacatcacctacacgcttcttcccattcgcatgcgagccgcagtgctcagc
ggcctgggcctctccactctgcatttgattttggcctggcagctcaacagcagcgacccc
ttcctttggaagcagctgggtgctaacatggtgctcttcctctgcaccaacgccatcggt
gtctgcacacactaccccgctgaagtgtctcagcgccaagcctttcaggagacccgaggt
tacatccaggcgcggctgcacctgcagcatgagaaccgtcagcaggaacggctgctgcta
tcggtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaaaaaagaa
gacatgatgttccacaagatctacatccagaagcacgataatgtcagcatcctgtttgcg
gacattgagggcttcaccagcctggcctcccagtgcaccgcgcaggaactggtcatgacc
ttgaatgagctcttcgcccggtttgacaagctggctgcggagaatcattgtctgaggatc
aagatcttaggagactgttactactgcgtgtcagggctacctgaggcccgggcagaccac
gcccactgctgtgtggaaatgggggtagacatgatcgaggccatctcgctggtgcgtgag
gtaacaggtgtgaacgtgaacatgcgcgtgggcatccacagcggacgtgtgcattgcggc
gtccttggcctgcggaaatggcagtttgacgtctggtccaatgatgtgaccctggccaac
cacatggaggccgggggccgggccggccgcatccacatcactcgggctacactgcagtac
ctgaacggggactatgaggtggagccaggccgtggtggtgagcgcaacgcatatctcaag
gagcagtgcattgagaccttcctcatactgggcgccagccagaaacggaaagaggagaag
gccatgctggccaagcttcagcggacgcgggccaactccatcgaaggactgatgccccgc
tgggttcctgaccgcgccttctcccggaccaaggactctaaagcattccgccagatgggc
atcgatgactctagcaaagacaaccggggtgcccaagatgctttgaaccctgaagatgag
gtggatgagttcctgggccgagccatcgatgcccgaagcatcgaccaactgcgtaaggac
cacgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtattcacgg
aaagtagatcctcgcttcggagcctatgtcgcctgtgccctcctggttttttgctttatc
tgtttcatccagctcctcgtattcccatactccaccctgatactcgggatttatgccgct
atcttcctattgttgctggtcactgtgctgatttgcgccgtgtgttcctgtggctctttc
ttccccaaggccctgcaacgcctgtcccgcaatatcgtccgctctcgggtgcacagcacc
gcggttggaatcttctcggttctgcttgtgttcatctctgccatcgccagcatgttcacc
tgtaatcacaccccaataaggacctgcgcggcccggatgctgaacttaacaccagcggat
gtcaccgcctgccacctccaacagctcaattactctctgggactggatgctcccctgtgt
gagggcgccgcacccacctgcagcttccctgagtacttcgtcgggaatgtcctgctgagt
ctcttggccagctctgtcttcctacacatcagcagcatcggcaagctggccatgaccttc
gtcttggggttcacctacttggtgctgcttttgctaggtcccccagctgccatctttgac
aactatgatctactgcttggtgtccatggcttggcttcctccaatgagacctttgatgga
ctggactgcccagctgtggagagggtagcgctcaaatatatgacccctgtgattctgctg
gtgtttgccctcgcactgtacctgcatgcacaacaggtggaatccactgcccgcctggac
ttcctgtggaagctacaggcgacaggggagaaggaggagatggaggagctgcaggcatac
aaccggaggttgctgcataacattcttcccaaggacgtggccgcccacttcctggcccgg
gaacgccgcaacgatgagctgtactaccagtcgtgtgaatgtgtggctgtcatgtttgcc
tccattgccaatttctctgagttctacgtggagctagaggcaaacaacgagggtgtggag
tgcctgcggctgctcaatgagatcatcgccgactttgacgagatcatcagtgaggagagg
ttcaggcagttggagaagatcaagacaatcggtagcacctacatggccgcctctgggcta
aatgccagcacctatgaccaggccggccgatcgcacatcacggcgctggccgactatgcc
atgcggctcatggagcagatgaagcacatcaatgaacactctttcaacaacttccagatg
aagatcgggttgaacatgggtccagttgtagcaggcgtcattggggcccgaaagccacag
tatgacatctggggaaataccgtgaatgtttccagtcgtatggacagcactggagttcct
gatcgaatacaggtgaccacggacctgtaccaggttctagctgccaagggctaccagctg
gagtgtcgaggggtggtcaaggtgaagggaaagggggagatgaccacctacttcctcaac
gggggccccagcagttag

KEGG   Mus pahari (shrew mouse): 110334612
Entry
110334612         CDS       T05929                                 
Symbol
Adcy8
Name
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04742  Taste transduction
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110334612 (Adcy8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110334612 (Adcy8)
   04371 Apelin signaling pathway
    110334612 (Adcy8)
   04020 Calcium signaling pathway
    110334612 (Adcy8)
   04072 Phospholipase D signaling pathway
    110334612 (Adcy8)
   04024 cAMP signaling pathway
    110334612 (Adcy8)
   04022 cGMP-PKG signaling pathway
    110334612 (Adcy8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110334612 (Adcy8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110334612 (Adcy8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110334612 (Adcy8)
   04062 Chemokine signaling pathway
    110334612 (Adcy8)
  09152 Endocrine system
   04911 Insulin secretion
    110334612 (Adcy8)
   04923 Regulation of lipolysis in adipocytes
    110334612 (Adcy8)
   04912 GnRH signaling pathway
    110334612 (Adcy8)
   04913 Ovarian steroidogenesis
    110334612 (Adcy8)
   04915 Estrogen signaling pathway
    110334612 (Adcy8)
   04914 Progesterone-mediated oocyte maturation
    110334612 (Adcy8)
   04921 Oxytocin signaling pathway
    110334612 (Adcy8)
   04926 Relaxin signaling pathway
    110334612 (Adcy8)
   04935 Growth hormone synthesis, secretion and action
    110334612 (Adcy8)
   04918 Thyroid hormone synthesis
    110334612 (Adcy8)
   04928 Parathyroid hormone synthesis, secretion and action
    110334612 (Adcy8)
   04916 Melanogenesis
    110334612 (Adcy8)
   04925 Aldosterone synthesis and secretion
    110334612 (Adcy8)
   04927 Cortisol synthesis and secretion
    110334612 (Adcy8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110334612 (Adcy8)
   04270 Vascular smooth muscle contraction
    110334612 (Adcy8)
  09154 Digestive system
   04970 Salivary secretion
    110334612 (Adcy8)
   04971 Gastric acid secretion
    110334612 (Adcy8)
   04972 Pancreatic secretion
    110334612 (Adcy8)
   04976 Bile secretion
    110334612 (Adcy8)
  09156 Nervous system
   04724 Glutamatergic synapse
    110334612 (Adcy8)
   04727 GABAergic synapse
    110334612 (Adcy8)
   04725 Cholinergic synapse
    110334612 (Adcy8)
   04720 Long-term potentiation
    110334612 (Adcy8)
   04723 Retrograde endocannabinoid signaling
    110334612 (Adcy8)
  09157 Sensory system
   04742 Taste transduction
    110334612 (Adcy8)
   04750 Inflammatory mediator regulation of TRP channels
    110334612 (Adcy8)
  09149 Aging
   04211 Longevity regulating pathway
    110334612 (Adcy8)
   04213 Longevity regulating pathway - multiple species
    110334612 (Adcy8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110334612 (Adcy8)
   04714 Thermogenesis
    110334612 (Adcy8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334612 (Adcy8)
   05207 Chemical carcinogenesis - receptor activation
    110334612 (Adcy8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110334612 (Adcy8)
   05163 Human cytomegalovirus infection
    110334612 (Adcy8)
  09165 Substance dependence
   05032 Morphine addiction
    110334612 (Adcy8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110334612 (Adcy8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110334612 (Adcy8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110334612 (Adcy8)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110334612 (Adcy8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom TBK1_ULD
Other DBs
NCBI-GeneID: 110334612
NCBI-ProteinID: XP_021072029
Ensembl: MGP_PahariEiJ_G0019846
LinkDB
Position
17:complement(30317650..30526479)
AA seq 1253 aa
MELSDVHCLSGSEELYTIQPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGD
GGGGGGSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGPGERAHNTGGTKVFPERSGSGSA
SGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQR
RKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDNTS
HTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLG
TSLLQVTLQVLTPRLVVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVE
ARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFA
DVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDH
AHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIAN
KLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLP
EDIVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQAL
HVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVC
AFIVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWI
NETYLARNVIIFASILINFLGAVLNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVF
TGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTK
EASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSH
VARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADF
DELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEIN
KHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYL
ILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLG
LVQSLNRQRQKQLLNENSNSGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggagctctcggatgtgcactgccttagtggcagcgaggaactctacaccatccaaccg
acgcccccggccggcgacggcgggagcggctctcggccgcagcgactgctgtggcagacg
gcggtgcggcacatcacggagcagcgcttcatccacgggcaccgaggcggcggcggcgac
ggtggcggcggcgggggctcccgcaaagcctcgaaccctgcgggcagcggacccaatcac
cacgcgccgcagctgtctagtgactcggtgctgcctctctattctctgggcccgggagag
cgagcgcacaacaccggtggcaccaaagtctttccggaacggagcgggagcggcagtgcc
agtggcagcgggggcgggggcgacttgggcttcctacaccttgactgtgccccaagtaac
tcggatttcttcctcaatggagggtacagctaccgaggggtcattttcccaaccctacgc
aactccttcaagtctcgggatctggagcgcctctaccaacgctatttcctgggccagagg
cgcaaatcggaggtagtgatgaacgtgttggatgtactaaccaaactcacccttttagtc
ctgcacttgagcctggcctcggctcccatggaccctctcaagggcatcctgctaggcttt
ttcactggcatcgaggtggtgatctgcgccctcgtggtggtcaggaaggacaacacctcc
cacacttacctgcaatacagcggcgtggtcacttgggtggctatgaccacccagattctg
gcagcaggcctgggctatgggcttctgggcgacggcataggctacgtgctttttacactc
ttcgccacctacagcatgcttccgctgcctctcacctgggccatcttggccggcctgggc
acatccttgctgcaagtcacccttcaagtactcacacccaggctagtggtcttttccatc
aaccaggtcctggcccaggtggtgctattcatgtgcatgaatacagcaggaatcttcatc
agttacctttcagatcgtgcccagcgccaggccttcctggagacccggaggtgtgtggag
gccaggctccgcctggagacagagaaccaaagacaggagcggcttgtgctgtctgtgctc
cccaggtttgtcgtcctagaaatgatcaacgacatgaccaatgtggaagatgagcatctg
cagcatcagttccaccgcatctacatccatcgatatgagaacgtcagtattctttttgca
gatgtcaaaggatttaccaacctctctacgaccttgtctgctcaggagctggtcaggatg
ctcaacgagctctttgccagattcgaccggctggcccatgagcatcactgtcttcgaatt
aaaatcctgggggactgctactactgtgtgtctggactgcctgagccccgccgggatcac
gctcattgctgtgttgaaatgggcctcagcatgatcaaaactatcaggtttgtgagatcc
agaacgaagcacgatgtcgacatgcgaattggaattcattcaggttctgtgctatgtggt
gtgttgggcctgaggaaatggcagtttgatgtctggtcttgggacgtggatatagcaaac
aagcttgaatctggaggaatccctgggaggattcacatttctaaagccaccctggattgc
ctcaatggtgactataacgtggaagagggccatgggaaagaaaggaatgaattcttgagg
aagcataacatagagacctatttgattaagcagcccgaggagagtttgctctccttgcct
gaagacatagttaaggagtcagtgagctgctccgacaggagaaacagtggggcaacattc
acagaaggatcttggagcccagagctgcctttcgacaacatcgtgggcaaacagaatact
ctggctgccctaacaagaaattcaataaatctgcttccaaaccatctcgcacaagctttg
catgtccagtctgggcctgaggaaattaacaagagaatagagcataccatcgacttgcgg
agtggcgataagttgagaagagaacatatcaagccattctcactgatgtttaaagactcc
agcctggagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgt
gcatttatcgttcttctgtttatcactgcgattcaaagtttgcttccttcttcaaggctg
atgcctatgactatccagttctccatcctgatcatgctgcactctgccctggtcctcatc
accacagcagaagactataagtgtctgcccctcatcctccgcaaaacctgctgttggatt
aacgagacctatctggcccgcaacgtcatcatctttgcttccatcttgattaacttcctg
ggagctgtcctaaatattctgtggtgtgattttgacaagtcgatacccttgaagaacctg
actttcaattcctcagctgtgtttacagatatctgctcctacccagagtacttcgtcttc
actggggtgttggccatggtgacctgtgcagtatttctgcggcttaactctgtcctgaag
ctggctgtgctgctcattatgattgccatctatgccctgctgacagagaccatctacgca
ggtctctttctgagttatgacaacctgaaccacagtggagaagatttcctggggaccaag
gaagcatcattgctgctgatggccatgttccttcttgctgtgttctaccatggacagcag
ctggagtacacagcccgcctggatttcctgtggcgcgtacaggccaaagaggagatcaac
gagatgaaggaactgagggagcacaacgagaacatgctgcgcaatatcttacccagccac
gtggcccgccacttcctggagaaggacagagacaatgaggagctgtattctcaatcctac
gatgccgttggggtgatgtttgcctccatccctggatttgcagacttctactctcagaca
gaaatgaacaaccagggagtggaatgtctgcgcttgctgaatgagatcattgctgacttt
gatgagctgctcggggaggaccggtttcaggacattgagaagattaagaccattggtagt
acatacatggctgtctcaggactgtcaccagagaaacagcaatgtgaagataaatgggga
catttgtgtgccctggccgacttctctctggccctgactgagagcatacaagagatcaac
aagcattcattcaacaattttgaactccgaattggcatcagccatggctcagtggtagca
ggtgtaattggcgctaagaaaccacagtatgacatttgggggaaaactgtgaacttggca
agccgaatggacagcacgggagtgagtggccggatccaagttcctgaggagacctatctt
atcctgaaggaccagggctttgcctttgactaccgtggggagatatatgtgaagggcatc
agtgaacaagaagggaaaattaaaacatactttctcctgggacgagtccaacccaaccca
ttcatcttacccccaaggagacttcctgggcaatactctctggctgcggttgtccttggc
cttgtccagtctctcaacaggcaaaggcagaagcaactactcaacgagaacagcaactcg
ggcatcatcaagagccattacaaccggcggactttgctaacgccaagtgggccagagcct
ggagcacaagctgaaggcactgacaaatccgatttgccataa

KEGG   Mus pahari (shrew mouse): 110337453
Entry
110337453         CDS       T05929                                 
Symbol
Adcy7
Name
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
mpah01522  Endocrine resistance
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04114  Oocyte meiosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04611  Platelet activation
mpah04713  Circadian entrainment
mpah04714  Thermogenesis
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04727  GABAergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04918  Thyroid hormone synthesis
mpah04921  Oxytocin signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04976  Bile secretion
mpah05032  Morphine addiction
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05207  Chemical carcinogenesis - receptor activation
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110337453 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337453 (Adcy7)
   04371 Apelin signaling pathway
    110337453 (Adcy7)
   04020 Calcium signaling pathway
    110337453 (Adcy7)
   04072 Phospholipase D signaling pathway
    110337453 (Adcy7)
   04024 cAMP signaling pathway
    110337453 (Adcy7)
   04022 cGMP-PKG signaling pathway
    110337453 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110337453 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110337453 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110337453 (Adcy7)
   04062 Chemokine signaling pathway
    110337453 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    110337453 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    110337453 (Adcy7)
   04912 GnRH signaling pathway
    110337453 (Adcy7)
   04913 Ovarian steroidogenesis
    110337453 (Adcy7)
   04915 Estrogen signaling pathway
    110337453 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    110337453 (Adcy7)
   04921 Oxytocin signaling pathway
    110337453 (Adcy7)
   04926 Relaxin signaling pathway
    110337453 (Adcy7)
   04935 Growth hormone synthesis, secretion and action
    110337453 (Adcy7)
   04918 Thyroid hormone synthesis
    110337453 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    110337453 (Adcy7)
   04916 Melanogenesis
    110337453 (Adcy7)
   04925 Aldosterone synthesis and secretion
    110337453 (Adcy7)
   04927 Cortisol synthesis and secretion
    110337453 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110337453 (Adcy7)
   04270 Vascular smooth muscle contraction
    110337453 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    110337453 (Adcy7)
   04971 Gastric acid secretion
    110337453 (Adcy7)
   04972 Pancreatic secretion
    110337453 (Adcy7)
   04976 Bile secretion
    110337453 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    110337453 (Adcy7)
   04727 GABAergic synapse
    110337453 (Adcy7)
   04725 Cholinergic synapse
    110337453 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    110337453 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110337453 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    110337453 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    110337453 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110337453 (Adcy7)
   04714 Thermogenesis
    110337453 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337453 (Adcy7)
   05207 Chemical carcinogenesis - receptor activation
    110337453 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110337453 (Adcy7)
   05163 Human cytomegalovirus infection
    110337453 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    110337453 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110337453 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110337453 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110337453 (Adcy7)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110337453 (Adcy7)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N
Other DBs
NCBI-GeneID: 110337453
NCBI-ProteinID: XP_021076040
Ensembl: MGP_PahariEiJ_G0022955
LinkDB
Position
20:12603352..12659152
AA seq 1099 aa
MPAKGRYFLNEGDEGPNQAALYEKYRLTSLHGPLLLLLLLVAVATCIALISIAFSHEDLR
RHQVVLGTAFFMLTLFVALYVLVYVECLVQRWLRALALLTWACLMVLGSVLMWDSLENKA
HAWEQVPFFLFIVFVVYALLPLSRRAAIAVGVASTVSHLLVFGAVTRAFQTSMSSTQLGL
QLLANAVILLGGNFTGAFHKHQLQDASRDLFIYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKEGSDRHYMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGHGELRDPYLKEMNIRTYLVIDPRSQQPPPPSHHLSKPKGDATLKM
RASVRVTRYLESWGAARPFAHLNHRESVSSSETLIFNGRGQKAIPLRRHRAPDRSASPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREYRLVSIPRARYDFAC
ASLVFICILLIHLLVMPRMATLGMSFGLVACLLGLVLIFCFATEFSRCFPSRSTLQAISE
SVETQPLVRLVLVVLTVGSLLTVAIINMPLTLNPSPEQPGDNETSPLAARDRIGTPCELL
PYYTCSCILGFIACSVFLRMSLELKAMLLTVALVAYLLLFNLSPCWHVSGNSTETNGTNR
TRLLLSAAQSMPSHTLAPGARVTAPSPSCLERDLKIMINFYLILFYATLILLSRQIDYYC
RLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVM
FASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAA
GLSAPSGHENQDLERKHVHIGVLVEFSLALMSKLDGINRHSFNSFRLRVGINHGPVIAGV
IGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGE
LRTYFVCTDTAKFQGLGLN
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctaaatgagggtgatgaaggccccaaccaggcagca
ctctatgagaagtaccggctcaccagcctgcacgggccactgctgctcttgctcctcctg
gtggccgtggccacctgcattgcgctcatcagcatcgccttcagccatgaggatctccgc
agacaccaggttgtcctgggcactgcgttcttcatgctgacactgtttgtggctctctat
gtgctggtgtacgtcgagtgcctggtgcagcggtggctgcgggccttggctctactcacc
tgggcttgcctcatggtactaggctccgtgctgatgtgggactccttggagaacaaagcc
catgcgtgggagcaggtgcctttcttcctgttcatcgtctttgtggtgtatgcactgctg
cctctcagcaggagggcagccatcgcggtgggcgtggcctccacggtctcccacctcctt
gtgtttggagctgtgacaagagccttccagacatccatgtccagcactcagctggggctg
cagctcctggccaatgctgttatcctcctgggtgggaacttcacgggtgccttccacaag
caccagctgcaggatgcgtccagggatctctttatctacaccgtcaagtgcatccagatt
cgtcggaagcttcgtgtggagaagcgccagcaggagaacctgcttctttcggtgctccca
gctcacatctccatgggcatgaagctggccatcattgagcgcctcaaagagggtagtgac
cgacactacatgccggacaacaactttcacagcctctatgtcaagcggcaccagaatgtc
agcatcctgtatgcagacatcgtgggcttcacgaggctggccagcgactgctctcccaag
gagctggtggtggtgctcaatgagctgttcgggaagtttgaccagattgctaaggccaac
gagtgcatgcggatcaaaatcctgggtgactgttactactgcgtgtcaggcctgcccgtg
tcactgcccacgcatgcccgcaactgtgtgaagatgggtctggacatatgcgaggccatt
aagcaggttcgcgaggccacgggagtggacatcagcatgcgtgtgggcattcactccggg
aacgtgctatgtggggtcatcgggctccgtaagtggcagtatgacgtgtggtcccatgat
gtgtccctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagag
gcgacattgaatcacctggacaaggcgtacgaggtggaggatgggcacggggagctgcga
gacccctatctgaaagagatgaacatccgaacctacctggtgatcgatccccggagccag
cagccgcccccacccagccaccacctctccaagcccaagggggatgcgactctgaagatg
cgggcttcagtgcgtgtaacccgctatctggagtcttggggggcagcacggccctttgca
cacctcaaccaccgggagagtgtgagcagcagcgagaccctcatcttcaacggacggggg
cagaaggccattcctctgcgtcgacaccgtgcccctgataggagtgcatcccccaaggga
cgcttggaagatgactgtgacgacgagatgctgtcagccattgaggggctcagctctacc
aggccctgctgctccaagtctgatgacttccacacctttggtcccatcttcctggagaag
ggctttgagcgtgagtaccgcctggtgtccatcccccgggctcgctatgactttgcctgt
gccagccttgtcttcatctgcatcctgctcatccaccttctagtgatgcccaggatggca
actctgggcatgtcctttggactggtggcctgcctgctggggctggttctgattttctgc
tttgctactgagttttcgaggtgctttccatcccgaagtacactccaggccatctcggag
agtgtggagacacagcccctggtcaggcttgtcctggttgtgttgactgtaggcagccta
ctgactgtcgccatcatcaacatgccactgacacttaacccaagcccagagcagcctgga
gacaacgagacaagcccactggctgcacgggacagaattgggaccccatgtgaactcctc
ccgtactacacctgcagctgcatcctgggcttcattgcatgctctgttttcctgcggatg
agcctggagttgaaggccatgctgctgacagtggccttggtggcctacctgctactcttc
aacctctctccgtgctggcatgtctccggcaacagcactgagaccaacgggacaaacagg
acacggctgctcctgtctgctgcacaaagcatgcccagccacacccttgctcccggggct
cgggtgactgccccctcccccagttgtttagagagagacctgaagatcatgatcaacttc
tacctgatcctgttctatgccaccctcatcttgctgtctagacagattgactactactgc
cgcttggactgtctgtggaagaagaagttcaagaaagagcatgaggagtttgaaacaatg
gagaatgtgaaccgcctcctcctggagaatgtgctgccggcgcacgtggctgcccacttc
attggggacaaggcagcagaggactggtaccatcagtcttacgactgtgtctgtgtcatg
tttgcatccgttccggacttcaaagtgttctacactgagtgtgatgtcaacaaagaagga
ctggagtgccttcgcctgctgaatgagatcattgctgattttgatgagctgctgctgaag
cccaagttcagtggtgtggagaagatcaagaccattggcagcacctacatggcggcagca
gggctcagtgccccctcaggacatgagaaccaggacctggagcggaagcacgtgcacatc
ggagtcttggtggaatttagcttggccctgatgagcaagctggatggaatcaacaggcac
tccttcaactccttccgcctccgagtcggcataaaccacgggcctgtgattgctggagtg
attggagcacgcaagcctcagtatgacatctggggaaacacagtcaatgttgccagccgc
atggagagcaccggagagcttgggaaaatccaggttactgaagagacatgcaccatcctc
cagggactaggatattcttgtgagtgccgtgggctgatcaacgtcaaaggcaaaggggaa
cttcggacttattttgtatgtacagacactgccaagtttcaagggctggggctaaactga

DBGET integrated database retrieval system