KEGG   Mus pahari (shrew mouse): 110324855
Entry
110324855         CDS       T05929                                 
Symbol
Bdkrb2
Name
(RefSeq) B2 bradykinin receptor isoform X1
  KO
K03916  bradykinin receptor B2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah05142  Chagas disease
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110324855 (Bdkrb2)
   04071 Sphingolipid signaling pathway
    110324855 (Bdkrb2)
   04022 cGMP-PKG signaling pathway
    110324855 (Bdkrb2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110324855 (Bdkrb2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324855 (Bdkrb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110324855 (Bdkrb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110324855 (Bdkrb2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110324855 (Bdkrb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324855 (Bdkrb2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110324855 (Bdkrb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110324855 (Bdkrb2)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Bradykinin
    110324855 (Bdkrb2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 110324855
NCBI-ProteinID: XP_021058227
Ensembl: MGP_PahariEiJ_G0029846
LinkDB
Position
7:99611409..99636473
AA seq 392 aa
MPCSWKRPGLLSVYEPMPTTASCGIEMFNVTTQVLGSALNGTLSEDNCPDTEWWSWLNAT
QAPFLWVLFLLAALENLFVLSVFCLHKNSCTVAEIYLGNLAAADLILACGLPFWAITIAN
NFDWVFGEVLCRMVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSL
VIWGCTLLLSSPMLVFRTMRDYREEGHNVTACVIVYPSRSWEVFTNVLLNLVGFLLPLSV
ITFCTVRILQVLRNNEMKKFKEVQTERKATVLVLSVLGLFVLCWVPFQISTFLDTLLRLG
VLSGCWDEHAVDVITQISTYVAYSNSCLNPLVYVIVGKRFRKKSREVYRALCQKGGCMGE
PVQMENSMGTLRTSISVERQIHKLQDWAGNKQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgccctgctcctggaagcgacccgggcttctgtcggtgtatgagcccatgcccaccacg
gcctcctgtggcatcgaaatgttcaacgtcaccacacaagtcctcgggtctgcccttaac
gggactctttcggaggacaactgcccagacaccgagtggtggagctggctcaatgccacc
caggcccccttcctctgggtcctcttcctgctggccgcactggagaacctctttgttctc
agcgtgttctgcctgcacaagaacagctgcactgtggccgagatctacctgggcaacctg
gcagccgcggacctcatcctggcctgcgggttacccttctgggccatcaccatcgccaat
aacttcgactgggtgtttggagaggtgctgtgccgcatggtaaacaccatgatctacatg
aacctgtacagcagcatctgcttcctgatgctcgtgagtatcgaccgctacctggcgctg
gtgaagaccatgtccatgggccggatgcgcggggtgcgctgggccaaactctacagcctg
gtgatctggggctgtacgctgcttctgagttcgcccatgttggtgttcaggaccatgagg
gactaccgcgaagagggccacaacgtcaccgcctgtgtcatcgtctacccgtcccgctcc
tgggaggtgttcaccaacgtgctgctgaacctggtgggtttcctcctgcccctgagcgtc
atcaccttctgcacggtgcgcatcttgcaggtgctgaggaacaatgagatgaagaagttc
aaggaggtccagacggagaggaaggccaccgtgctggtgctgtccgtcctggggctcttc
gtgctatgttgggtgcccttccagatcagcaccttcctggacacgctgctgcgtctcggc
gtgctgtcgggatgctgggacgagcacgccgtagacgtcatcacgcagatcagtacctac
gtggcctacagcaacagctgcctcaacccgctggtgtacgtgatcgtgggcaagcgcttc
cggaagaagtcccgagaggtgtaccgggcactgtgccagaagggaggctgcatgggagaa
cccgtccagatggagaattccatggggactctgaggacctcgatctccgtggaaaggcag
atccacaagctgcaggactgggcagggaacaaacagtga

KEGG   Mus pahari (shrew mouse): 110325005
Entry
110325005         CDS       T05929                                 
Symbol
Bdkrb1
Name
(RefSeq) B1 bradykinin receptor
  KO
K03915  bradykinin receptor B1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04610  Complement and coagulation cascades
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110325005 (Bdkrb1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110325005 (Bdkrb1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110325005 (Bdkrb1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110325005 (Bdkrb1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110325005 (Bdkrb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325005 (Bdkrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110325005 (Bdkrb1)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Bradykinin
    110325005 (Bdkrb1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 110325005
NCBI-ProteinID: XP_021058444
Ensembl: MGP_PahariEiJ_G0029847
LinkDB
Position
7:99646584..99647723
AA seq 332 aa
MASQALLELQPSNQSQQAPPNITSCEGAPEAWDLLYRVLPGFVITVCFFGLLGNLLVLSF
FLLPWRRWWRQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVV
SGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGYRRRRRAQATCLLIWVAGGLLSIPTF
FLRSVTVVPDLNISACILLFPHEAWHFARMVELNILGFLLPLAAILYFNFHILASLRGQK
EASRCGGPKGSKTTGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCSWKELTDLGLQ
LANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgtcccaggccttgctggagctacagccttccaaccaaagccagcaggcgcctccc
aacatcacctcctgtgagggcgccccggaagcctgggatctgctgtatcgggtgctgcca
gggtttgtcatcactgtctgtttctttggcctcctggggaaccttttagtcctgtccttc
ttccttttgccttggcgacggtggtggcggcagcggcggcagcgcctaaccatagcagag
atctacctggctaacttggcagcttctgatctggtgtttgtgctgggcctgcccttctgg
gcagagaacgttgggaaccgtttcaactggccctttggaagtgacctctgccgggtggtc
agcggggtcatcaaggccaacctgttcatcagcatcttcctggtggtggccatcagtcag
gaccgctacaggttgctggtataccccatgaccagctgggggtaccggcggcgacggcga
gcccaagcaacctgcctgctcatctgggtagctgggggcctcttgagcatccccacgttc
tttctgcgctctgtcacagtcgtccctgatctgaacatctctgcctgcattctgcttttc
ccccacgaagcttggcactttgcaaggatggtggagttgaacattttgggttttctcctc
ccattggctgccatcctctacttcaactttcacatcctagcctccctgagaggacagaag
gaggccagccggtgtgggggacctaagggcagcaagacaacggggctgatcctcacactg
gtggcctccttcctggtctgctgggccccttaccacttctttgccttcctggatttcctg
gtccaggtgagagtgatccaggactgctcctggaaggagctcacggacctgggcctgcag
ctggccaacttctttgcttttgtcaacagctgcctgaacccactgatttatgtctttgca
ggccggctctttaagaccagggttctgggaactttataa

DBGET integrated database retrieval system