KEGG   Mus pahari (shrew mouse): 110324936
Entry
110324936         CDS       T05929                                 
Symbol
Nrxn3
Name
(RefSeq) neurexin 3 isoform X1
  KO
K07377  neurexin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110324936 (Nrxn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110324936 (Nrxn3)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110324936 (Nrxn3)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan hEGF DUF202
Other DBs
NCBI-GeneID: 110324936
NCBI-ProteinID: XP_021058325
Ensembl: MGP_PahariEiJ_G0029757
LinkDB
Position
7:83866760..85457447
AA seq 1627 aa
MSFTLHSVFFTLKVSIFLGSLVGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETTVLSNKQVNDSSWHFLMVSRDRVR
TGLVIDGEGHSGELRPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQSMPGFKGLMLDLK
YGNSEPRLLGSQSVQLEAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGTLCSEENSP
GPAHLQLGDEGKEENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKS
ADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMV
TISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNND
IRLELSRLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFD
FRTTEPNGLILFTHGKPQERKDVRSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQ
KKANDGEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLIL
PTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKN
NAVCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKVIMPMVMHTEAEDVSFRFM
SQRAYGLLVATTSRDSADTLRLELDGGRVKLMVNLGKGPETLYAGQKLNDNEWHTVRVVR
RGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGL
LYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLTLATLQAYTSMHLFFQFKTTS
ADGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDN
SNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVD
LNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGN
QCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDF
LQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHY
PTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLV
GEVPSVSGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTTMKESTTPTSDDLVSSAEC
SSDDEDFVECEPSTGGELVIPLLVEDPLATPPIATRVPSITLPPTFRPLLTIIETTKDSL
SMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVTDKSLS
TSIFEGGYKAHAPNRTTTTSLSPELIRFTASSSSGMVPKLPAGKMNNRDLKPQPDIVLLP
LPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGASEVIRESSSTTGMVVGIVA
AAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQASSKSGHKKQKN
KDKEYYV
NT seq 4884 nt   +upstreamnt  +downstreamnt
atgagctttaccctccactcagttttcttcaccttgaaggtgagcatctttctgggctcc
ctggtggggctttgcctgggtctggaattcatgggcctccctaaccagtgggcccgctac
ctgcgctgggatgcaagcacgcgcagtgacctgagcttccagttcaagaccaatgtttcc
actgggctgctcctgtatttggatgatggtggtgtctgtgacttcctctgcctctccctg
gtggatggtcgtgttcagctccgctttagcatggactgcgccgagaccactgtcttgtcc
aacaagcaggtgaacgacagcagttggcacttcctcatggtgagccgcgatcgtgtgcgc
actgggctggtgattgacggcgagggccactctggagagctacggccccagcggccctat
atggatgtggtcagtgatttgttcctcggtggcgttcctgctgacattcgaccttctgcc
ctgaccctcgatggagtacagagcatgcctggctttaagggattaatgctggatctcaag
tatggcaactcggaacctcggcttctggggagccagagcgtccagttagaagcagaggga
ccctgtggcgagcgtccctgtgaaaatggtgggatctgcttcctcttggatggtcatccc
acctgtgactgttctaccactggctatggcggcacactctgctcagaagaaaattctcct
ggaccagcccaccttcaacttggagatgaaggaaaggaggagaacgtggccaccttccga
ggctcagagtatctgtgctatgacctgtcccagaaccccatccagagcagcagcgacgaa
atcaccctttcctttaagacctggcaacgcaatgggctcatcctccacactggcaagtcg
gccgattatgttaacctggctctgaaggatggtgcggtctctttggtcattaacctgggg
tccggggcctttgaggccattgtggagccagtgaatgggaaatttaacgacaacgcctgg
catgatgtcaaagtgacacgcaatcttcggcagcactcaggcatcggacacgctatggtg
acaatctctgtggatggcatcctaaccacaacgggctacactcaagaggactacaccatg
ctgggctcagatgacttcttctatgtcggtggaagcccaagtaccgcagacttgccaggc
tcacctgtgagcaacaacttcatgggctgccttaaagaggttgtttataagaataatgac
atccgtctagagctgtctcgcttggcccggattggggacaccaagatgaaaatctatggt
gaagttgtgttcaagtgtgagaacgtggccacactggatcccatcaactttgagacccca
gaggcttacatcagcttgcccaagtggaacaccaaacgtatgggctccatttcctttgac
tttcgcacaactgagcccaatggcctgattctcttcactcatgggaagccccaagaaagg
aaagatgtccggagccaaaagaacacaaaagttgacttctttgctgttgaacttcttgat
ggcaacctgtatttgctgcttgacatgggctctggcaccatcaaagtgaaggccactcag
aagaaagccaatgatggggaatggtaccacgtggacattcagcgtgatggcagatcaggt
accatatctgtgaacagcaggcgcacgccattcactgccagtggggagagtgaaattctg
gacctggagggggacatgtatctgggcggactgccagaaaaccgagctggcctcattctc
cccacggagctctggaccgccatgctcaactatggttatgtgggctgcatccgcgacctg
ttcattgatgggcgcagcaagaacattcggcagctggcggagatgcagaacgcagcgggc
gtcaagtcctcctgttcacgcatgagcgccaagcagtgtgacagctacccctgcaagaac
aatgcggtgtgcaaggacggctggaaccgcttcatctgcgactgcactggcaccggctac
tggggaagaacctgcgaaagagaggcatccatcctgagctatgacggcagcatgtatatg
aaggtcatcatgcccatggtgatgcacacggaggcagaggatgtgtccttccgcttcatg
tcacagcgagcctatgggctactggtagccacgacctccagggactctgcagatacactt
cgtctagagttggatggtgggcgtgtcaagctcatggttaacttaggcaaaggacctgag
accctgtatgcagggcagaagctcaatgacaatgagtggcacaccgtccgggtagtgcgg
agaggaaaaagccttaagctaacagtggatgatgatgtggctgagggtactatggtgggc
gaccacacccgcctggaattccacaatattgaaactggtatcatgactgagaagcgttac
atctctgtggtcccctccagtttcattggccatctacagagcctcatgttcaatggcttg
ctgtacattgatttgtgcaaaaatggtgacatcgactactgtgaactgaaggctcgcttt
ggactgagaaacatcatcgctgaccctgtcacttttaagaccaagagcagctacctgacc
ctcgccaccctgcaggcttacacctccatgcacctcttcttccagttcaagaccacttca
gctgatggcttcattctcttcaatagcggagatggcaatgattttattgcggttgaactt
gtcaaggggtacatacactatgtgtttgatcttggcaacggtcccaatgtgatcaaaggc
aacagtgaccgccccctgaatgacaaccagtggcacaacgtggtcatcactagggacaac
agtaatacccacagcctgaaggtggacaccaaggtagtcactcaggtcatcaatggtgcc
aaaaatctggatttgaaaggtgacctctatatggctggcttagcccagggcatgtacagc
aaccttcccaagctcgtggcctcccgggatggatttcagggctgcctggcctctgtggac
ttgaacggacgtctgcctgatctcatcaatgatgctctccacaggagtggacagattgag
cgaggctgtgaaggacccagtacaacctgtcaggaggattcatgtgccaaccagggggtt
tgcatgcagcagtgggaaggcttcacctgtgactgctccatgacatcatattctggaaac
cagtgcaatgaccctggtgcaacatacatctttgggaaaagtggtggcctcatcctctat
acctggccagcaaatgacagacccagcacacgctctgaccgcctcgccgtgggcttcagc
actactgtgaaggatggtatcttagtacgcattgacagtgcccctggacttggtgacttc
ctccagcttcacatagaacaagggaaaattggagttgtcttcaatattggcacagttgac
atctccatcaaagaagagagaacccccgtcaatgatggcaaataccacgttgtgcgcttc
accaggaatgggggaaatgctacacttcaggtggacaactggccagtgaatgagcattat
cctacaggccggcagctaaccatcttcaacacccaggcgcaaatagccattggaggaaag
gacaaaggacgtctcttccaaggtcaactctctgggctctattatgatggtttgaaagta
ctgaatatggcagctgagaacaaccctaatattaaaatcaatggaagtgtccggctagtg
ggagaagtcccatcagtctcgggaacaacacagacaacatccatgccacctgaaatgtct
accactgtcatggaaaccactaccaccatggctacaaccaccacccgcaagaaccgctct
acaactatgaaagaaagtaccacacccacatcagatgatcttgtttcatctgctgaatgt
tcaagcgatgatgaagactttgtcgaatgtgaaccaagtacaggaggtgaattagttatt
cctcttctggtagaagaccctttagctacccctcctattgctactcgtgtaccctccatt
acactcccccctaccttccgccccctcctcaccattattgagaccaccaaagattccctg
tccatgacctctgaggcggggttaccttgcttgtcggaccaaggcagcgatggttgtgat
gatgatggcttggtgatatctgggtatggctcaggggaaacctttgactctaacctgccc
cctactgatgatgaagatttttacaccaccttctccttggtaacagataagagtctttcc
acttcaatcttcgaaggtggctacaaagcacatgcgcccaatagaactacaaccacctct
ttgtcccctgagctgatccgcttcacagcgtcctcctcgtctgggatggtgcccaaattg
ccagctggcaaaatgaataaccgtgatctcaaaccccagcctgatatagtcttgcttccg
ttgcccactgcctatgagctagacagcaccaaactgaagagcccactaattacttccccc
atgttccgtaatgtgcccacagcaaaccccacggagccaggaatcagacgggttccgggg
gcctcagaggtgatccgggagtccagcagtacaacagggatggtcgtcggcattgtggct
gctgccgccctctgcatcttgatcctcctgtacgccatgtacaagtacaggaacagggac
gaggggtcctatcaagtggacgagacgaggaactacatcagcaactcggcccagagcaac
ggcacgctcatgaaggagaagcaagccagctccaagagcggccataagaaacagaaaaac
aaggacaaggagtattatgtgtaa

KEGG   Mus pahari (shrew mouse): 110328701
Entry
110328701         CDS       T05929                                 
Symbol
Nrxn2
Name
(RefSeq) neurexin-2-beta isoform X1
  KO
K07377  neurexin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110328701 (Nrxn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328701 (Nrxn2)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110328701 (Nrxn2)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan DUF202 hEGF
Other DBs
NCBI-GeneID: 110328701
NCBI-ProteinID: XP_021063784
Ensembl: MGP_PahariEiJ_G0014104
LinkDB
Position
1:117824275..117939090
AA seq 1710 aa
MALGSRWQPPPQLPPLLLLLALAAGVRGLEFGGGPGQWARYARWAGAASTGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGA
GVGGHSSTQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGESEVLDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPSAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVD
NVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGD
ITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSG
NGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDS
RTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIA
DALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYI
FGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTV
GVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERL
AIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKV
LALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRG
RSPTMRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRS
PFVPPPPTFYPFLTGVGATQDTLPPPAARRPSSGGPCQAERDDSDCEEPVEASGFASGEV
FDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPRPNLRTDGATGAPGVLFAPSAPAPNLPA
GKMNHRDPLQPLLENPPLGPGVPTAFEPRRPPPLRPGVTSAPGFPRLPTANPTGPGERGP
PGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQ
SNGAVVKEKAPAAPKTPSKAKKNKDKEYYV
NT seq 5133 nt   +upstreamnt  +downstreamnt
atggcgctcgggagtcggtggcaaccgccaccccagctgccgccgctgctgttgctgctg
gcgctggcggcgggcgtccgtggcttggagttcggcggcggccccgggcagtgggctcgc
tacgcgcgctgggcgggagcggcgagcaccggcgagctcagcttcagcctgcgcaccaac
gccacgcgcgcgctgctgctctacctggacgacggcggcgactgcgacttcctggagctg
ctgctggtggacgggcgcctgcggctgcgcttcacgctgtcttgcgccgagcccgccacg
ctgcagctggacacaccggtggccgacgaccgctggcacatggtgctgctgacccgcgac
gcgcggcgcacggcgctggcggtggacggcgaagcccgcgctgccgaggtccgctcaaag
cggcgcgagatgcaggtggccagcgacctgttcgtgggcggcatccctcccgacgtgcgc
ctatctgcgctcacgctcagcactgtcaagtacgagccgcctttccgcggcctcctggcc
aacctgaagctgggcgagcggccgccggcgctgctgggtagccagggtctgcgcggtgct
gccgctgaccccctgtgcgcgcctgcgcgcaatccctgcgccaacggcggtctctgcacc
gtgctagcccccggcgaggtgggctgcgactgcagccacactggcttcggcggcaagttc
tgcagtgaagaggaacaccccatggaaggtccggctcacctgacgttaaacagcgaagta
gggtccttactgttctccgaggggggggccgggagaggaggagccggcgatgtgcaccag
ccgacaaaaggcaaggaggaatttgtggcaaccttcaagggcaatgagttcttctgctac
gacctgtcccacaacccgatccagagcagcacggacgagatcacgctggccttccgcacc
ctgcagcgcaacgggctgatgctgcacacgggcaagtcggctgactacgtcaacctgtcc
ctcaagtccggggctgtctggctggtcatcaacctaggctcgggtgccttcgaggccctc
gtggaacccgtcaatggcaagttcaatgacaacgcctggcacgacgtccgggttacccga
aacctgcgccagcacgcagggattggacacgctatggtaaacaaactgcattatctggtg
accatctcggtggacgggatcctgaccaccacaggctacacgcaggaggattacaccatg
ctgggctctgatgacttcttctacattgggggcagccccaacacagccgacctgcctggc
tcacctgtcagcaacaacttcatgggctgcctcaaggacgtggtctacaagaataacgac
ttcaagctggaactgtcccgactggctaaggaaggggacccgaagatgaagctgcagggg
gatttgtctttccgttgtgaggacgtggccgccttggaccctgtgacctttgagagtcct
gaggcctttgtcgcgctgccccgctggagcgccaagcgcactggttccatctccctggac
ttcagaaccactgagcccaatgggttgttgctcttcagccagggccggcgggctggggcc
ggggtaggcggccacagttctacccagagggccgactactttgccatggagctgttggac
ggttacctctaccttctgctggacatgggctccgggggcatcaagctgcgggcgtccagc
cgcaaggtcaacgacggcgagtggtgccacgtggacttccagagggacgggcgcaaaggc
tccatctctgtgaacagccgcagcacgccattcttggccacaggagagagcgaggtcctg
gacctggagagtgagctgtacctgggtggcctccccgaggggggccgagtggacctgcca
ctgccccctgaggtgtggacagctgctctccgggctggctatgtgggctgtgtgcgagac
ctcttcatcgatgggcgaagtcgagatctccgaggcctggctgaggcacaaggggctgtg
ggcgttgctcctttctgctcccgggagaccctgaagcagtgtgcatcggccccgtgtcga
aacgggggcatctgtcgagagggctggaaccgattcgtctgtgattgcatcgggaccggc
tttctgggtcgggtctgcgagagagaggccacggtcttgagctatgatggctccatgtac
atgaagatcatgctgcccagtgcgatgcacacggaagcagaggatgtgtccctgcgcttc
atgtcccagagggcgtatggactcatgatggccaccacctccagggagtcggctgacact
ctgcgtctcgagctggatggggggcagatgaaactcacggtcaacctcgactgcctgcgc
gtcggctgcgcacccagtaaaggccccgagacactgtttgcggggcacaagctcaacgac
aatgagtggcacacggtgagggtggtccggcgtggcaagagcctgcagctgtctgtggac
aacgtgactgtggagggacagatggcaggagcccacactcggctggagttccacaacatt
gagacgggcatcatgacagagcggcggtttatctctgtggtgccctccaacttcatcggg
cacctgagtgggctggtgttcaatggtcaaccctacatggaccaatgcaaagatggagac
atcacctattgtgagcttaatgcccgctttggcctgcgtgccattgtggctgatcctgtc
acgttcaagagtcgcagcagctacctggcgttggccacgttgcaagcctacgcttccatg
catctcttcttccagttcaagaccacggccccagatggacttctgctgttcaactcgggc
aacggcaacgacttcatcgtcatcgagttggtcaaggggtacatccactacgtgtttgac
ctgggaaatggcccgtccttgatgaagggaaactcagacaaaccagtcaatgacaaccaa
tggcacaatgtggtggtgtccagggacccaggcaatgtgcacacgctgaagattgactcc
cgcacagtcacgcagcattccaacggtgcccgaaatctggatctcaaaggggagttgtac
atcggtggcctgagcaagaacatgttcagcaacctgcccaagttagtggcctctcgggac
ggctttcaaggctgcctggcttctgtggacctcaacgggcgcctcccagacctcatcgct
gatgccctgcaccgcatcgggcaggtggagaggggctgtgacggccccagcaccacctgc
accgaagagtcttgtgccaaccagggcgtctgtctgcagcagtgggatggctttacctgt
gactgtactatgacttcctatggaggccctgtctgcaatgaccccgggaccacatacatc
ttcgggaaggggggagcgcttatcacctatacgtggcctcccaatgacaggcccagcaca
cggatggaccgcctggccgtaggcttcagcacccaccagcggagcgctgtgctggtgcga
gtggacagtgcctccggcctcggggactacctgcagctgcacattgaccagggcactgtt
ggggtgatttttaatgtgggcacggacgacattacaattgatgagcccaacgccatcgtg
agcgacggcaaatatcatgtggtgcgctttactagaagtggtggcaatgccaccttgcaa
gtggacagctggccagtcaacgagaggtacccggcagggaactttgataacgagcgcctg
gcgattgctagacagagaatcccctaccggcttggtcgagtagtagatgagtggctgctc
gacaaaggacgccagctgaccatcttcaacagccaggctgccatcaagatagggggccgg
gatcagggccgccccttccagggccaggtgtccggcctctactacaatgggctcaaggta
ctggcgctggccgccgagagcgaccccaatgtgcggaccgaaggccacctacggctagta
ggggaggggccgtccgtgctgctcagtgctgagaccaccgccaccactctgctggccgac
atggccaccaccatcatggagaccaccaccaccatggccaccaccactactcgccggggc
cgttcccccacaatgagggacagcaccacccagaacacagatgacctcctggtggcctcg
gctgagtgtccaagtgatgatgaggacctggaggagtgtgagcctagtactggaggagag
ttaatattgcccattatcacggaggactccttagacccccctcctgtggccacccgatcc
cccttcgtgcccccgccccccaccttctacccctttctcacgggcgtgggtgccacccaa
gacaccctgcctccgcccgccgcgcgccgcccgtcctcggggggcccgtgtcaggccgag
cgcgacgacagcgactgcgaggagcccgtggaagcctcgggcttcgcctccggggaggtc
tttgactccagcctcccccccacggacgacgaggacttttacaccacttttcccttggtc
acggaccgcaccaccctcctgtcgccccgcaagccccgacctaacctcaggacagatggg
gccacgggcgcccccggggtgctatttgcgccctccgccccagcccccaacctgcccgcg
ggcaaaatgaaccaccgagacccattgcagccgctactggagaacccacccctggggcct
ggggtccccacggccttcgagccgcggcggccgcctcccttgcgccccggcgtgacctca
gcccccggtttcccccgtctgcccacagccaaccccacgggtccgggggagcgcggcccg
ccgggcgcggtggaggtgatccgcgaatccagcagcaccacgggcatggtggtgggcatc
gtggcggcggcggcgctctgcatcctcatcctcctctacgccatgtacaagtaccgcaac
cgcgacgagggctcctaccaggtggaccagagccggaattacatcagtaactcggcccag
agcaatggggcggtggtgaaggagaaggcccccgctgcccccaagacgccaagcaaggcc
aagaagaacaaagacaaagagtattacgtctga

KEGG   Mus pahari (shrew mouse): 110335619
Entry
110335619         CDS       T05929                                 
Symbol
Nrxn1
Name
(RefSeq) neurexin-1 isoform X1
  KO
K07377  neurexin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110335619 (Nrxn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110335619 (Nrxn1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    110335619 (Nrxn1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan hEGF DUF202
Other DBs
NCBI-GeneID: 110335619
NCBI-ProteinID: XP_021073518
Ensembl: MGP_PahariEiJ_G0020949
LinkDB
Position
18:complement(55428958..56498990)
AA seq 1546 aa
MGTALVQRGGCCLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQGKACPTPLIYYDSDQGKYTCMTTGKPLNRKWVNDNNAEGLAHL
MMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSA
DYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVN
KLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEV
VYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKT
GSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTI
KIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPEN
KAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSKETAKPCL
SNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAED
VSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAG
YNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSV
PSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATL
QAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNK
PLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPK
LVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQ
WDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQK
EAVLVRVDSSSGLGDYLELHIHQGKVGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSG
GNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAT
IIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTAT
AMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPS
SGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEG
SYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV
NT seq 4641 nt   +upstreamnt  +downstreamnt
atggggacggcgttggtccagcgcgggggctgctgtctcctctgcctgtcgctgctgctg
ctgggttgctgggcagagctgggcagcgggctggagttcccgggcgccgagggccagtgg
acgcgcttccccaagtggaacgcttgctgcgagagtgagatgagcttccagctgaagacg
cgcagtgcccgcggcctcgtgctctacttcgacgacgagggcttctgcgacttcctcgag
ctcatcctaacacgcggcggccgcctgcagctcagcttctccatcttctgcgccgagccc
gccacgctattggctgacacgccggtcaacgacggcgcctggcacagcgtgcgcatccgc
cgccagttccgcaacaccacgctctacatcgaccgtgccgaggccaagtgggtggaggtc
aagtccaagcgcagggacatgacggtgttcagcgggctcttcgtgggcggcctgccgcct
gaactgcgcgccgcggccctcaagctcacgctggcctcggtgcgcgagcgcgagcccttc
aagggctggatccgtgacgtcagggtcaactcgtcgcaggcgctgcccgtggacggcggc
gaggtcaagctggacgacgagcctcccaacagcggtggcgggagcccatgcgaggcgggc
gaagaaggcgagggcggcgtgtgcctcaacgggggcgtgtgctccgtggtcgacgaccag
gccgtgtgcgactgctcgaggaccggcttccgtggcaaggactgcagccaaggtaaggcc
tgcccgaccccgcttatttattatgacagtgaccaaggaaaatatacttgtatgactaca
ggaaaacctctaaacagaaagtgggtgaatgacaacaatgcggaaggtctggcgcacctg
atgatgggcgaccaaggtaaaagtaaaggaaaagaagagtatattgccacattcaaggga
tctgaatacttctgctacgacttatctcaaaaccccattcaaagcagcagcgatgaaata
actctgtcctttaaaactcttcagaggaatggactgatgcttcacacagggaaatcagct
gattatgtcaatcttgcattgaaaaatggagctgtctctctggtcattaatttgggatca
ggggcctttgaagcactagtggagcctgtgaatggaaagtttaatgataatgcctggcat
gatgtgaaagtcaccaggaatctgcgtcagcactcaggcattggacacgctatggtaaac
aaactacattgttcggtgacaatatcagtggatgggattcttaccacaacgggctacacg
caagaagattacaccatgctggggtctgatgactttttctatgttggaggcagccccagc
acagccgaccttccagggtcaccagtcagtaacaactttatgggctgtctcaaagaggtt
gtatataaaaataatgatgtaaggctggagttatcacgacttgccaagcaaggagatcct
aagatgaagattcacggtgtggtggcttttaagtgtgaaaatgtggcgaccttagaccca
ataacttttgagaccccggaatctttcatttctttgcctaagtggaatgcaaagaaaaca
ggctcaatatcatttgatttccgtacaacggagccaaatggcctcatcctgtttagccat
ggcaagccaagacatcagaaggatgccaagcacccacagatgattaaggttgactttttt
gctatcgagatgctggacggccacttgtacctcctcttagacatgggatcaggtactata
aaaatcaaagccctgcagaagaaagtaaatgatggagaatggtatcacgtggatttccag
cgggacggacggtcaggtaccatttctgtcaacacactacgcactccctacacagctccc
ggtgagagtgagatcctggacctagatgatgagttgtacctaggtggcttgccagaaaat
aaggctggcctggtctttcctaccgaggtgtggactgctctgctcaactatggctatgtg
ggctgcatccgggatctattcattgatggccagagcaaagacatccggcagatggcggaa
attcagagtactgctggagtaaagccatcctgctcaaaagagacagcaaaaccgtgcctt
agcaatccttgcaaaaacaatggcatgtgcagagatggctggaacagatacgtctgtgat
tgctctggaacaggctatctcggcaggtcctgtgaaagagaggcaacggttttgagctat
gacgggagtatgttcatgaaaattcagctcccggtggtgatgcacactgaggctgaggac
gtgtccttacggttcagatcccagcgtgcatatggtattctgatggcgaccacttctaga
gactctgcagacacccttcgactggagctagatgcaggacgtgtgaaactcacggtcaat
ctagattgtatcaggattaactgtaattccagcaaaggtcctgagaccctttttgctggc
tataacctcaatgataatgaatggcacacagtgcgtgtggttcggcgaggaaaaagctta
aagctaactgtggatgatcaacaagccatgacaggccaaatggcaggtgatcatacaagg
ctggagtttcataacatcgagacaggcatcatcacagaacgacgttatctttcttctgtc
ccctccaatttcattgggcacctgcaaagcctgacatttaatggaatggcatacatagac
ttgtgcaaaaatggtgatatagattactgtgaactcaatgccaggtttggattcaggaac
atcatcgcagatcctgtcaccttcaagaccaaatcgagctatgttgccttagctacattg
caagcctacacttctatgcatctatttttccaattcaagacaacatctctagatggacta
attctgtataacagtggagatggaaatgactttattgtggttgaattagttaaagggtac
ttgcattatgtgtttgacttgggaaacggtgctaacctcatcaaagggagctcaaacaaa
ccactcaatgacaatcagtggcacaatgtgatgatttcacgggacaccagcaatctccac
acagtaaagatcgacacgaaaatcacaacacagatcactgcgggagctagaaatttagac
cttaagagtgacttgtatattggaggagtggctaaagaaacatataaatccttgccaaaa
ctggtccatgcgaaagaaggctttcaaggttgcctggcatctgtggacttgaatggcagg
cttccagatctcatctctgatgctctcttctgcaatgggcaaattgagagaggatgtgaa
gggcccagcacaacctgccaagaggactcatgttcaaatcaaggcgtttgcttgcagcaa
tgggacggcttcagctgtgactgtagcatgacttccttcagtggcccgctctgcaatgac
cctgggacaacatatatctttagcaaaggtggtggacagattacatataagtggcctccc
aatgaccgccctagtacacgagcagacaggctggccatcgggtttagcactgtccagaag
gaagcagtgttggtgcgtgtggacagttcctcaggcctgggtgactaccttgagctgcac
atacaccaaggaaaagttggagttaagtttaatgttgggacagatgacatcgccattgaa
gaatctaatgcaatcattaatgatgggaaataccatgtagtacgtttcacaaggagtggt
ggcaatgccacgttacaggtggacagctggccagttatcgagcgctaccctgcaggaaac
aatgataacgagcgcctggcgattgctagacagcgaattccatatcgacttggtcgagta
gttgatgaatggctactcgacaaagggcgtcagctcacaatcttcaatagccaagcaacc
ataataattggcgggaaagagcagggccagcccttccagggccagctctctgggctttac
tacaatggcttgaaagttctgaatatggcagcagagaacgatgccaacatcgccatagtg
gggaatgtgaggctggtcggtgaagtgccttcctctatgacaactgagtcgacagccact
gccatgcagtctgagatgtccacctcaatcatggagactaccacaaccctggctaccagc
acagctagaagaggaaagccccccacaaaggaacccatcagccagaccacagatgatatc
cttgtggcctccgcagagtgtcccagcgacgatgaggacattgacccctgtgagccgagc
tcaggtgggttagccaaccccaccagagtgggcggccgcgaaccatacccaggctccgca
gaggtgatacgggagtccagcagtaccactggcatggtggtggggattgttgcagcagct
gctctgtgcatcctcatcctcctatatgccatgtacaagtacagaaaccgggatgaaggg
tcataccacgtggatgagagtcgaaactacatcagtaactcagcacagtccaatggggct
gtggtcaaggagaagcagcccagcagtgctaaaagcgccaacaaaaacaagaaaaacaag
gataaggagtattatgtctga

DBGET integrated database retrieval system