KEGG   Mus pahari (shrew mouse): 110325312
Entry
110325312         CDS       T05929                                 

Gene name
Fbxl3
Definition
(RefSeq) F-box/LRR-repeat protein 3
  KO
K10269  F-box and leucine-rich repeat protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110325312 (Fbxl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110325312 (Fbxl3)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     110325312 (Fbxl3)
SSDB
Motif
Pfam: F-box-like F-box DUF4116 F-box_5
Other DBs
NCBI-GeneID: 110325312
NCBI-ProteinID: XP_021058894
Ensembl: MGP_PahariEiJ_G0030590
LinkDB
Position
8
AA seq 428 aa
MKRGGRDSDQDSAEEGTAEKPKRPRTTHERSQPCDWGNLLQDIVLHVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaaacgaggaggaagagatagtgaccaggactcggctgaggaaggcactgctgagaag
cccaagagaccgaggacgactcacgagcgctcgcagccttgtgactggggtaacctcctg
caggacatcgtcctccatgtttttaagtatttgcctcttcttgaccgggcccatgcttcc
caagtgtgccggaattggaaccaggtatttcacatgcctgacttgtggcgatgttttgaa
tttgaactgaatcagccagcgacatcttacttgaaagccacacacccagagctgatcaaa
cagattatcaaaaggcactcaaaccacctacagtatgtcagcttcaaggtggacagcagc
aaagagtcagccgaagcagcttgtgatatattgtcacagcttgtgaattgctctttaaaa
acactcggacttatctcaaccgctcggccgagctttatggatctaccaaagtctcatttt
atctctgcactgacagttgtgtttgtaaactccaagtccctgtcctcacttaagatagac
gacaccccagtggatgacccatcccttaaagtcctcgtggccaacaacagcgacacgctc
aagctgctgaaaatgagcagctgtcctcatgtctctccagcagggattctgtgtgtggcc
gatcagtgtcatggcttacgagaactggccctgaactaccatttgctaagtgatgagttg
ttgctcgcactgtcttctgaaaagcatgttcgcttagaacatttgcgcattgatgttgtc
agcgagaaccctggacagacacacttccacactattcagaagagcagctgggatgccttc
atcaaacactcaccgaaagtcaacctagtgatgtatttttttttatacgaagaggaattt
gacccattctttcgttatgaaatacctgctactcatctttactttgggagatcagtcagc
aaagatgtgcttggccgtgtgggcatgacctgcccgagactagtggaactggtagtgtgt
gccaatgggttgcggccccttgatgaagagttaattcgcattgcagaacgttgcaagaat
ctgtcagctattgggctgggggaatgtgaagtctcatgtagtgcctttgttgagtttgtg
aagatgtgtggtggccgcctgtctcagttatccattatggaagaagtgttaattcctgac
caaaagtatagtttggaacaaattcattgggaagtgtctaagcatcttggcagggtatgg
ttccccgacatgatgcctacttggtaa

DBGET integrated database retrieval system