KEGG   Mus pahari (shrew mouse): 110325641
Entry
110325641         CDS       T05929                                 
Symbol
Plau
Name
(RefSeq) urokinase-type plasminogen activator
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04064  NF-kappa B signaling pathway
mpah04610  Complement and coagulation cascades
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110325641 (Plau)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110325641 (Plau)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110325641 (Plau)
   05206 MicroRNAs in cancer
    110325641 (Plau)
   05205 Proteoglycans in cancer
    110325641 (Plau)
  09162 Cancer: specific types
   05215 Prostate cancer
    110325641 (Plau)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110325641 (Plau)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110325641 (Plau)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     110325641 (Plau)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110325641 (Plau)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110325641 (Plau)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Prokineticin Trypsin_2
Other DBs
NCBI-GeneID: 110325641
NCBI-ProteinID: XP_021059416
Ensembl: MGP_PahariEiJ_G0030015
LinkDB
Position
8:12449008..12455945
AA seq 433 aa
MKVYLASLFLCALVVKNSEGGSVLGTPDESNCGCQNGGVCVSYKYFSSIRRCSCPKKFQG
EHCEIDTSKTCYHGNGQSYRGKANSDTKGRPCLAWNAPAVLQKTYNAHRPDAISLGLGKH
NYCRNPDNRKRPWCYVQIGLKQFVQECMVHDCSLSKKPTSSVDQQGFQCGQKALRPRFKI
VGGEFTEVENQPWLATIYKKNKGGSPPFFKCGGSLISPCWVASAAHCFINFPKKENYVVY
LGQSKQSTYNPGEMKFEVEQLILHEDYSESSLAYHNDIALLKIRTSTGQCAQPSRSIQTI
CLPPRFADAPFGSDCEITGFGQESFSDYLYPTNLKMSVVKLISHEECSQPHYYGSEINTK
MLCAADPEWKTDACKGDSGGPLICNIDGRPTLSGIVSWGEECSKKNKPGVYTRVSRFLSW
IQSHIGGERSLGF
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaagtctatctggcgagcctgttcctctgcgccttggtggtgaaaaactctgaaggt
ggcagtgtacttggaactcctgatgaatcaaactgtggctgtcagaacggaggtgtatgc
gtgtcctacaagtacttctccagcattcgccgatgcagctgcccaaagaaattccaaggg
gagcactgtgagatagatacatcaaaaacctgctatcatggaaatggtcaatcttaccga
ggaaaggccaacagtgataccaaaggtcggccctgcctggcctggaatgcgcctgctgtc
cttcagaaaacctacaatgcccacagacctgatgctattagcctaggcctggggaaacac
aattactgcagaaaccctgacaaccggaagcgaccctggtgctatgtgcagattggccta
aagcagtttgtccaagaatgcatggtgcatgactgctctcttagtaaaaagcctacttcg
tctgtagaccaacaaggcttccaatgtggccagaaggctctaaggccccgctttaagatt
gttgggggagaattcacggaggtggagaaccagccctggcttgccaccatctacaagaag
aacaagggaggaagtccccccttctttaaatgtggtgggagtctcatcagtccttgctgg
gtggccagtgccgcgcactgcttcattaatttcccaaagaaggaaaactacgttgtctac
ctgggtcagtcgaagcagagcacctataatcccggagagatgaagtttgaggtggagcag
ctcatcttgcacgaagactacagtgaatccagcctggcctaccataatgatattgccttg
ctgaagatacgtaccagcacgggccaatgtgcacagccatccaggtccatacagaccatc
tgcctgcccccaaggtttgctgatgctccgtttggttccgactgtgagatcactggcttt
ggacaagagtctttcagtgactatctctatccaacgaacctgaaaatgtcggttgtaaag
cttatttctcatgaagagtgttcgcaaccccactactacggctctgaaattaatactaaa
atgctgtgtgctgcggacccagagtggaaaacagacgcctgcaagggcgattctggagga
ccgcttatctgtaacatcgatggccgcccaaccctgagtgggattgtgagctggggcgaa
gaatgttcaaagaaaaacaagcccggtgtctacacgagggtctcacgcttcctgagctgg
attcaatcccacattggaggagagagaagcctgggtttctga

DBGET integrated database retrieval system